KEGG   Saccharothrix espanaensis: BN6_85000Help
Entry
BN6_85000         CDS       T02404                                 

Gene name
rbsK
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sesp  Saccharothrix espanaensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN6_85000 (rbsK)
Enzymes [BR:sesp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN6_85000 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9311960..9312868)
Genome map
AA seq 302 aa AA seqDB search
MSPRRTSPSSRNDGVADVTVLVLGSANADLVVAVPRRPGGGETVLGGDTVVMPGGKGANT
AAAAGRLGCAVALVGAVGPDQYGDLLVRSLAEAGVRTDLVRTSDRPTGLAYITVTPDGEN
SIVVAPGANSDVSESDVDALAWDGVTVLVCSLEVPLATVVHGISVAASRGARPVLNLSPV
TEVPAATLALLDPLIVNEHEARELADTFEGLLDLGPRSVVVTLGARGAAVVTASGVVEVP
APAVTPVDTTGAGDAFAGALAAGLAAGQSLVEAARYAARVAATSVTRPGAQPSYPGPDEV
LE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccaagaagaacctcgccgagttcaagaaatgacggtgtcgctgacgtgacggta
ctggtgctcggctcggccaacgcggacctcgtcgtcgcggtcccccgccgccccggcggc
ggcgagacggtgctcggcggcgacacggtggtgatgcccggcggcaagggggccaacacc
gcggccgccgccgggcggctgggctgcgccgtcgcgctggtcggcgcggtcgggccggac
cagtacggggacctgctggtgcggtcgctggccgaggcgggggtgcggaccgacctggtc
cgcacctcggaccggccgacggggctggcctacatcaccgtgacgccggacggcgagaac
tcgatcgtcgtcgcaccgggcgcgaactcggacgtgtcggagtccgatgtggacgctctg
gcgtgggacggcgtgacggtcctggtgtgctcgctggaagtcccgttggcaaccgtggtg
cacgggatctcggtagcggcctctcgtggggcgaggccggtgctcaacctgtccccggtg
accgaggtgccggcggcgacgctggcgctgctggacccgctgatcgtcaacgagcacgag
gcgcgggaactggccgacacgttcgagggcctgctcgacctcggcccgcgctcggtcgtg
gtgacgttgggcgcgcgcggcgcggccgtggtcaccgcgtccggcgtggtcgaggtgccc
gcgccggccgtgacgccggtcgacaccaccggcgcgggcgacgcgttcgccggtgccctg
gccgccgggctggcggcgggccagtcgctggtcgaggccgcccggtacgcggcgcgggtc
gcggcgacctcggtgaccaggccgggcgcgcagccgtcctaccccgggccggacgaggtg
ctcgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system