KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN0683Help
Entry
SEN0683           CDS       T00776                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00020  Citrate cycle (TCA cycle)
set00190  Oxidative phosphorylation
set00650  Butanoate metabolism
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01130  Biosynthesis of antibiotics
set01200  Carbon metabolism
Module
set_M00009  Citrate cycle (TCA cycle, Krebs cycle)
set_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
set_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SEN0683 (sdhD)
   00650 Butanoate metabolism
    SEN0683 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SEN0683 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAR32269
Position
757757..758104
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactggcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system