KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN1054Help
Entry
SEN1054           CDS       T00776                                 

Gene name
yedO
Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:set00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1152028..1153014
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLELIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgctttcctcgcctggagcttattggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacgcccattgcaatgggcggcaataaactgcgtaagctggagtttctggtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcgaaccat
gtccgtcagacggcggcggtcgcggccaaattggggctgcattgcgtcgctttgctggaa
aatccaatcggtaccaccgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacgcaaattgagatgtgcgatgcgctaaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgattccggtcggcggc
tccagcgcgctgggggcaatgggatacgtagagagcgccctggaaatcgcccagcagtgt
gaagaagttgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgcctgacgtcgaactgattggcgtgaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgccttgcagcaggctattgccggt
cagctggcgctgacggcgacggcggatattcatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgagcctggagggg
gtgttgctggatccggtatataccggcaaagcgatggcgggtctgatagacggcatcagc
cagaaacgctttaacgatgacgggccgattctctttattcacaccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system