KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN1488Help
Entry
SEN1488           CDS       T00776                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00010  Glycolysis / Gluconeogenesis
set00071  Fatty acid degradation
set00350  Tyrosine metabolism
set00625  Chloroalkane and chloroalkene degradation
set00626  Naphthalene degradation
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01130  Biosynthesis of antibiotics
set01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEN1488 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SEN1488 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SEN1488 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SEN1488 (adhP)
   00626 Naphthalene degradation
    SEN1488 (adhP)
Enzymes [BR:set01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SEN1488 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C SCP2
Motif
Other DBs
NCBI-ProteinID: CAR33067
Position
complement(1584992..1585921)
Genome map
AA seq 309 aa AA seqDB search
MLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYE
GCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEECIVVADYAVKVPEGLDSAAASSITCAG
VTTYKAVKISHIKPGQWIAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDGQLKLAEEMGA
DLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPEAMNL
DIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEGKVVPKVALRPLEDINVIFKEMEQGQIR
GRMVIDFRR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaatggagtgctgcggcgtatgccataccgatctacacgtgaaaaacggcgat
ttcggtgacaaaaccggcgtcattctgggacacgaaggcattggcgtcgtggcggaagtc
ggtcctggtgtcacctcgctgaaacccggcgatcgcgcgagtgtcgcgtggttttatgaa
ggatgcggacactgtgagtattgcaatacgggcaatgaaaccttatgccgcaacgtgaaa
aatgccggttacacggtagatggcggcatggccgaagagtgtattgtcgtcgcggattat
gcggtgaaagtaccggaaggtctggactctgcggcggcaagtagtattacctgcgcgggc
gttaccacgtataaagcggtgaagatttctcatattaaacctggccagtggattgccatc
tacggtctgggcggtctgggtaatctggccttgcagtacgcgaaaaacgttttcaatgcg
aaagtgatcgccattgatgtcaatgatggacaactgaaactggccgaggaaatgggcgca
gatctgaccattaattcacgtacggaagatgcggctaaaattgtgcaggaaaaaaccggt
ggcgcgcacgcagcggtggttaccgcggtcgctaaggcggcgtttaattccgcagtagat
gccgttcgcgccggaggtcgcgtggtggcagtcgggctgccgccagaagccatgaacctt
gatatccctcgcctggtgctggatggcattcaggttgtcggttcgttggtggggacacgc
caggatctgaccgaagccttccagttcgcggcggaaggaaaagtcgtgccaaaagtcgct
ttacgtccgcttgaagatatcaacgttatttttaaagagatggaacaagggcaaattcgt
ggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system