KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN1488Help
Entry
SEN1488           CDS       T00776                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SEN1488 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEN1488 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SEN1488 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SEN1488 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SEN1488 (adhP)
   00626 Naphthalene degradation
    SEN1488 (adhP)
Enzymes [BR:set01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SEN1488 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1584992..1585921)
Genome map
AA seq 309 aa AA seqDB search
MLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYE
GCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEECIVVADYAVKVPEGLDSAAASSITCAG
VTTYKAVKISHIKPGQWIAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDGQLKLAEEMGA
DLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPEAMNL
DIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEGKVVPKVALRPLEDINVIFKEMEQGQIR
GRMVIDFRR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaatggagtgctgcggcgtatgccataccgatctacacgtgaaaaacggcgat
ttcggtgacaaaaccggcgtcattctgggacacgaaggcattggcgtcgtggcggaagtc
ggtcctggtgtcacctcgctgaaacccggcgatcgcgcgagtgtcgcgtggttttatgaa
ggatgcggacactgtgagtattgcaatacgggcaatgaaaccttatgccgcaacgtgaaa
aatgccggttacacggtagatggcggcatggccgaagagtgtattgtcgtcgcggattat
gcggtgaaagtaccggaaggtctggactctgcggcggcaagtagtattacctgcgcgggc
gttaccacgtataaagcggtgaagatttctcatattaaacctggccagtggattgccatc
tacggtctgggcggtctgggtaatctggccttgcagtacgcgaaaaacgttttcaatgcg
aaagtgatcgccattgatgtcaatgatggacaactgaaactggccgaggaaatgggcgca
gatctgaccattaattcacgtacggaagatgcggctaaaattgtgcaggaaaaaaccggt
ggcgcgcacgcagcggtggttaccgcggtcgctaaggcggcgtttaattccgcagtagat
gccgttcgcgccggaggtcgcgtggtggcagtcgggctgccgccagaagccatgaacctt
gatatccctcgcctggtgctggatggcattcaggttgtcggttcgttggtggggacacgc
caggatctgaccgaagccttccagttcgcggcggaaggaaaagtcgtgccaaaagtcgct
ttacgtccgcttgaagatatcaacgttatttttaaagagatggaacaagggcaaattcgt
ggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system