KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN1526Help
Entry
SEN1526           CDS       T00776                                 

Gene name
yneH
Definition
(GenBank) probable glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00220  Arginine biosynthesis
set00250  Alanine, aspartate and glutamate metabolism
set00471  D-Glutamine and D-glutamate metabolism
set01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SEN1526 (yneH)
   00220 Arginine biosynthesis
    SEN1526 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SEN1526 (yneH)
Enzymes [BR:set01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SEN1526 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAR33105
UniProt: B5QTS1
Position
complement(1625721..1626647)
Genome map
AA seq 308 aa AA seqDB search
MAWAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcctgggccatggataatgcaattttagagacgattttacagcgcgttcgccccctc
attggccagggcaaagtcgctgactatattccggcattagcgtccgtcgagggttcaaag
ctggggatagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaa
cgcttctctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattat
ccggaagaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcg
ttggttcagttagagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcg
ctggtggtatgcgacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaa
gttgtgcgcgcgctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctct
gaatttgagcattccgcccgtaacgccgctattgcttggctgatgaaatcattcggtaat
tttcatcatgatgtgcctaccgtgttgcaaaattacttccactactgtgcgttgaaaatg
agctgcatggaactggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcat
ctcgacgagccggtagtgacccccatgcaggcccggcaaattaatgcgctaatggcgacc
agcgggatgtatcagaatgccggagagtttgcctggcgggtaggattgcccgctaaatcc
ggcgtgggcggtggtattgtcgccattgtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtatcgccgcgcttgaacaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system