KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN1750Help
Entry
SEN1750           CDS       T00776                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SEN1750 (pncA)
Enzymes [BR:set01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SEN1750 (pncA)
    3.5.1.-  
     SEN1750 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1857566..1858222
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVAEGDSTIDIANALIDWCQPRQIPVLASQDWHPAQHGS
FASQHQAEPYSQGELDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDACIYKGENPLIDSY
SAFFDNEHRQKTTLDTWLREHDVTELIVMGLATDYCVKFTVLDALELGYAVNVITDGCRG
VNIHPQDSAHAFMEMASAGATLYTLADWEETQGQAVAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgggccttattactggtcgacttgcaaaatgacttttgcgccggcggcgcg
ctggctgtagcggaaggcgacagtaccatcgacatcgccaacgctcttattgactggtgc
cagccccggcagattccggtgctggccagccaggactggcatcccgcgcagcatggcagc
ttcgccagccagcatcaggcggaaccctatagtcagggagagctggacgggctgccgcaa
acgctctggccggatcactgcgttcaacataccgacggcgcggcgttacatcccctgctt
aaccaacatgcgattgacgcctgcatctataagggtgagaacccgctgattgatagctac
agcgcgttttttgacaacgaacatcggcagaaaactacccttgatacctggcttcgcgag
catgacgttaccgagcttatcgtgatggggttggcgaccgattactgcgtaaaatttacg
gtgctggatgcgctagagttgggctatgccgttaacgttatcaccgatggctgtcgcggc
gtgaatattcacccgcaggatagcgcacacgcgtttatggagatggcgtcggcaggcgcg
acgctgtatacgctggcagactgggaagagacgcagggccaggctgtcgccaggtag

DBGET integrated database retrieval system