KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN2072Help
Entry
SEN2072           CDS       T00776                                 

Gene name
hisC
Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SEN2072 (hisC)
  Amino acid metabolism
   00340 Histidine metabolism
    SEN2072 (hisC)
   00350 Tyrosine metabolism
    SEN2072 (hisC)
   00360 Phenylalanine metabolism
    SEN2072 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SEN2072 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SEN2072 (hisC)
Enzymes [BR:set01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SEN2072 (hisC)
Amino acid related enzymes [BR:set01007]
 Aminotransferase (transaminase)
  Class II
   SEN2072 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2155349..2156428
Genome map
AA seq 359 aa AA seqDB search
MSTENTLSVADLARENVRNLVPYQSARRLGGNGDVWLNANEFPTAVEFQLTQQTLNRYPE
CQPKAVIENYAQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSVSA
ETIGVERRTVPALENWQLDLQGISDNLDGTKVVFVCSPNNPTGQLINPQDLRTLLELTRG
KAIVVADEAYIEFCPQATLTGWLVEYPHLVILRTLSKAFALAGLRCGFTLANEEVINLLL
KVIAPYPLSTPVADIAAQALSPQGINAMRDRVAQTVQERQYLVNALQQTACVEHVFDSET
NYILARFTASSSVFKSLWDQGIILRDQNKQPSLSGCLRITVGTRQENQRVIDALRAEPV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaacactctcagcgtcgctgacttagcccgtgaaaatgtccgcaacctg
gtaccgtatcagtctgcccgccgtctgggcggtaacggcgatgtctggctgaacgcgaat
gaattcccgacagcggtggagtttcagctcacccaacaaacgcttaaccgctacccggaa
tgccagccaaaggccgtgattgaaaactacgcgcaatatgctggcgtaaagccggagcag
gtgctggtcagccgcggcgcggatgaagggatcgagctggtgatccgcgccttctgtgaa
ccggggaaagacgctattctctactgtccgcccacttacggtatgtacagcgtcagcgcc
gaaaccattggcgtagagcgccggacggttcccgcgcttgaaaactggcagctggatcta
caggggatttccgacaaccttgacggcacaaaagtggtgttcgtttgtagccccaataat
cctaccggacaacttatcaacccgcaggatctgcgcacgctgctggagttgacacgcggt
aaagcgatagtcgtcgccgacgaagcttatattgagttttgcccgcaggccacgctgaca
ggctggctggttgaatatcctcatctggttatcctgcgcacattgtcgaaagcttttgcg
ctggcgggtctgcgctgcggctttacactggctaatgaagaggtgatcaacctgctgtta
aaagtgatcgccccttatccgctttctacgccagtggcggatatcgccgcccaggcgctg
agcccgcagggaataaacgcaatgcgcgatcgcgtggcgcagacagtgcaggaacgtcag
tatctggtgaatgccctgcaacagaccgcctgcgtagaacacgtctttgactctgaaacc
aactatattctggcgcggtttaccgcctccagcagcgtgtttaaatccttatgggatcag
ggcattatcttacgcgatcagaataaacaaccttctttaagcggctgcctgcggattacg
gtcggcacccgccaggaaaaccagcgcgtcattgacgccttacgtgcggagccagtatga

DBGET integrated database retrieval system