KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN2820Help
Entry
SEN2820           CDS       T00776                                 

Gene name
fucI
Definition
(GenBank) L-fuculose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00051  Fructose and mannose metabolism
set01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SEN2820 (fucI)
Enzymes [BR:set01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     SEN2820 (fucI)
    5.3.1.25  L-fucose isomerase
     SEN2820 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N1 Fucose_iso_N2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: CAR34399
UniProt: B5QWR0
Position
3016906..3018681
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALITEKMRHACGAQVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNASQYKRNEAQNRAVLKESLLMAMCIRDMMQGNKTLADKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLFGHQLTGTAQIFA
DVRTYWSPEAVERVTGQALSGLAEHGIIHLINSGSAALDGACKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKAMHDQLDARTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaatcggtatccgcccggtgattgatggacgtcgtatg
ggcgtacgcgagtcgctcgaagagcaaaccatgaacatggcgaaagcgacggcggcgctc
atcaccgagaaaatgcgccacgcctgtggggcacaagtggagtgcgtcattgcggatacc
tgtattgccggaatggcggaatccgccgcctgtgaagaaaaattcagtagccagaacgtg
ggcgtgaccattaccgttacgccgtgctggtgctatggcagcgaaaccattgatatggac
ccgatgcgtccaaaagccatctggggctttaacggcacagagcgtcctggggcggtttac
cttgccgcggcgctggcggcgcacagccagaaaggcattccagcgttctccatttatggc
catgacgtgcaggatgccgacgatacctccattcctgccgacgtcgaagaaaaactgctg
cgttttgcgcgggcagggttagcggtagccagcatgaaaggcaaaagctacctctccgtc
ggcggcgtgtcgatggggatcgcgggttccattgtcgatcataacttctttgaatcctgg
ctgggcatgaaggtgcaagcggtagatatgaccgaactgcgccgccgtatcgatcaaaaa
atttatgatgaggccgaactggagatggcgctggcgtgggcggataaaaacttccgctac
ggcgaagatcagaacgcctcgcagtataagcgcaatgaagcccagaaccgcgcggtgtta
aaagagagcctgctgatggcgatgtgtattcgcgatatgatgcagggcaacaagacgctg
gcggacaaagggttagttgaagaatcgctgggctacaacgccattgccgccggcttccag
ggccagcgccactggaccgatcaatacccgaacggcgataccgccgaagcgctgctcaat
agttcttttgactggaacggcgtacgcgaaccgtttgtcgtcgccaccgaaaatgacagt
ctgaacggcgtagcgatgctgttcggtcatcaactcactggtaccgcgcagatattcgcc
gacgtgcgaacctactggtcgccggaagccgtagaacgcgtcaccggccaggcgctcagc
ggcctggcggaacacggcattattcacctgattaattccggttctgccgctctggacggt
gcctgtaaacagcgcgacagcgaaggcaagccgaccatgaaaccgcactgggaaatcagc
caacaagaggcggatgcgtgtctggcggccaccgaatggtgcccggcgattcacgaatac
ttccgcggcggcggctactcatcccgttttctgaccgaaggcggcgtgccattcaccatg
actcgcgtgaatatcatcaaaggcctgggaccagtactgcaaatcgccgagggctggagc
gtcgaactgccgaaagcgatgcacgatcagcttgatgcccgcaccaactctacctggcct
accacctggtttgcgccgcgtcttaccggcaaaggcccgtttaccgatgtctattcggtg
atggcgaactggggcgctaaccacggcgtactcaccatcggccatgtaggggcagacttt
attactctcgccgcgatgctgcgtatcccggtatgtatgcacaacgtggaggaggcgaag
atctaccgtccttccgcctgggcggctcacggtatggatatcgaaggccaggattatcgc
gcctgccaaaattatggcccgctgtataaacgttaa

DBGET integrated database retrieval system