KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN2886Help
Entry
SEN2886           CDS       T00776                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Brite
Enzymes [BR:set01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SEN2886 (dsbC)
Secretion system [BR:set02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SEN2886 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3091675..3092337)
Genome map
AA seq 220 aa AA seqDB search
MAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSG
AHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGI
TVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQ
LGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtggcccatgcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagt
acggaaattcaggcctcgccagtggcagggatgaaaaccgtcctcactcacagcggcgta
ctgtacgtcactgatgacggcaaacatattattcaagggccgatgtatgacgtgagcggc
gcgcatccggtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaa
gagatgatcgtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatc
acctgcggctattgtcataagctacatgaagagatgaaagattataacgcgctggggatc
acggtacgttatctggccttcccgcgccaggggctggaaagccaggcggagcaggatatg
aaatctatctggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaag
ggcgtgaaaccggcaagctgtgacgtgaacattgctgatcattatgcgttgggcgtgcag
ttgggcgtcagcggtacgccagccattgtattgagtaacggctatgtggtgcctggctat
cagggaccgaaagagatgaaagcgtttcttgatgagcatcaaaaacagaccagtggtaaa
taa

DBGET integrated database retrieval system