KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN3301Help
Entry
SEN3301           CDS       T00776                                 

Gene name
nirB
Definition
nitrite reductase large subunit (EC:1.7.1.4)
Orthology
K00362  
nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SEN3301 (nirB)
Enzymes [BR:set01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     SEN3301 (nirB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3505130..3507673
Genome map
AA seq 847 aa AA seqDB search
MSKVRLAIIGNGMVGHRFIEDLLDKSDASLFDITVFCEEPRKAYDRVHLSSYFSHHTAEE
LSLVREGFYEKHGVKVLVGERAITINRQEKVIHSSAGRTVYYDKLIMATGSYPWIPPIKG
SETQDCFVYRTIEDLNAIEACARRSKRGAVVGGGLLGLEAAGALKNLGVETHVIEFAPML
MAEQLDQMGGEQLRRKIESMGVRVHTSKNTQEIVQQGNEARKTMRFADGSELEVDFIVFS
TGIRPRDKLATQCGLAVAQRGGIVINDTCQTSDPDIYAIGECASWNNRVYGLVAPGYKMA
QVAVDHILGSENAFEGADLSAKLKLLGVDVGGIGDAHGRTPGARSYVYLDESKEVYKRLI
VSEDNKTLLGAVLVGDTSDYGNLLQLVLNAIELPENPDSLILPSHAGSGKPAIGVDKLPD
SAQICSCFDVTKGDLIAAINKGCHTVAALKAETKAGTGCGGCIPLVTQVLNAELAKQGIE
VNNNLCEHFAYSRQELFHLIRVEGIKTFEELLAKHGKGYGCEVCKPTVGSLLASCWNEYI
LKPQHTPLQDTNDNFLANIQKDGTYSVIPRSAGGEITPEGLVAVGRIAREFNLYTKITGS
QRIGLFGAQKDDLPEIWRQLIEAGFETGHAYAKALRMAKTCVGSTWCRYGVGDSVGFGVE
LENRYKGIRTPHKMKFGVSGCTRECAEAQGKDVGIIATEKGWNLYVCGNGGMKPRHADLL
AADLDRDTLIKYLDRFMMFYIRTADKLTRTAPWLDNLEGGIEYLKSVIIDDKLGLNEHLE
EEMARLRAAVVCEWTETVNTPSAQVRFKHFINSDKRDPNVQVVPEREQHRPATPYERIPV
TLVEENA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcagactcgctattatcggtaatggtatggtcggccaccgctttattgag
gatctccttgataaatccgacgctagcctgttcgacattaccgtgttctgtgaagaaccc
cgtaaagcctatgaccgtgtccacctgtcatcctacttctctcaccacaccgcggaagag
ctctctctggtgcgtgaaggattttacgagaagcacggcgtaaaggtactggttggcgaa
cgcgcaattaccattaaccgtcaggagaaagtgattcactccagcgcgggtcgtaccgtt
tattatgacaagctgatcatggcgaccggttcctatccgtggatcccgccgattaaaggc
tccgaaacccaggattgcttcgtttaccgtaccattgaagacctcaacgctatcgaagcc
tgcgcccgtcgcagcaagcgcggggcggtggtcggcggcggtctgctggggctggaagcc
gctggcgcgctgaaaaacctcggcgtggaaacgcacgtcattgaatttgcgccaatgctg
atggcggaacaactcgatcaaatgggcggcgagcagctacgtcgcaagatcgaaagcatg
ggcgtgcgtgtacacaccagtaaaaacacgcaagagattgttcagcagggtaacgaagcg
cgtaagactatgcgttttgccgacggcagcgagctggaagtcgatttcatcgtcttctct
accggtattcgcccccgcgacaagctggctacccagtgcggtctggccgtcgcgcagcgc
ggcgggatcgtgattaacgacacctgccagacgtctgacccagatatctacgctatcggc
gagtgcgccagttggaacaaccgcgtttacggtctggtcgcaccaggctataaaatggcc
caggtcgccgttgaccatatcctcggcagtgaaaacgcctttgaaggggcggatctcagc
gccaagctgaagctgctgggcgtggacgtcggcggcatcggcgacgcgcatggccgcacg
ccgggcgcgcgtagttacgtttacctcgatgaaagcaaagaagtctacaaacgtctaatt
gtcagcgaagataacaaaacgctgctcggcgcagtactggtcggcgacaccagcgattac
ggcaatttgctgcaactggtactgaacgccatcgaactgccggaaaacccggattcgctg
atcctgccgtcgcacgcgggcagtggtaaacccgctatcggcgtggataaactgccggac
agcgcgcagatctgctcctgcttcgatgtgactaaaggcgatctgatcgccgctatcaat
aaaggctgccataccgtggcggcgctgaaagcggaaaccaaagccggaaccggctgcggc
ggctgcatcccgctggtgacgcaggtactgaacgccgaactggcgaaacagggtattgaa
gtcaacaacaacctgtgcgagcactttgcttattctcgtcaggaactgttccacttaatc
cgcgtggaaggtatcaaaacctttgaagaactgctggcgaaacacggtaaaggctacggc
tgcgaagtgtgtaagccgaccgtcggttcgctgctggcgtcgtgctggaacgaatacatc
ctcaagccgcagcacacgccgctacaggatactaacgataacttcctggcgaatatccag
aaagacggtacttactcggtgatcccgcgctcggcgggcggcgaaatcaccccggaaggt
ctggtggccgtggggcgtatcgcccgcgagtttaacctctataccaaaattaccggttct
cagcgtatcggtctgtttggcgcgcaaaaagacgatctgccggaaatctggcgtcagttg
attgaagccggtttcgaaaccggtcacgcgtacgccaaagcgctgcggatggcgaaaacc
tgcgtcggcagcacctggtgccgctacggcgtgggcgacagcgtcggtttcggcgtggag
ctggaaaaccgctacaaaggcattcgtaccccgcacaaaatgaaattcggcgtctccggc
tgtacccgtgaatgtgcggaagcgcagggcaaagatgtgggtatcatcgccacggagaaa
ggctggaacctgtacgtctgcggtaacggcgggatgaaaccgcgtcatgcggatctgctg
gcagccgatctcgatcgcgacacgctgatcaagtacctcgaccgctttatgatgttctac
atccgtactgccgacaaactgacccgtaccgcgccgtggctggataatctggaaggcggc
atcgagtacctgaaatcggtcatcatcgacgataagctgggcctgaacgaacatctggaa
gaagagatggcgcgcctgcgcgcagcggtggtctgcgagtggacagaaaccgttaacacc
ccatccgcacaggttcgctttaagcactttatcaacagcgacaaacgcgacccgaacgtc
caggttgtgcctgaacgtgaacagcatcgtccggccacgccgtatgaacgtatcccggtc
actctggtggaggaaaacgcatga

DBGET integrated database retrieval system