KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN3339Help
Entry
SEN3339           CDS       T00776                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SEN3339 (malQ)
Enzymes [BR:set01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SEN3339 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3552595..3554673)
Genome map
AA seq 692 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMHGTTTGPQAVVPNVKVYTA
GKKMALPVEGRGEFAWLLTTEEGVHYKGRVTGGKKLNLPATLPEGYHTLTLTQDEQRTHC
RIIVAPPRCYEPQALLEGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVATRGGAFI
GLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEAQAWWQMPATQQQLR
QARDAQWVDYATVTALKITALRMAWTRFAARDDAQMAEFRHFIAREGESLYWQAAFDALH
AYQVKEDEQRWGWPAWPEAYQSVESPAVKQFCEAHREEVEFYLWLQWLAWRQFAACWDTC
QSFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYGETADQGAYVHYPVDDLLSIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPGAYPQQSMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVILRGLYEDRERAKQGLLDALHKYGCLPK
RAGHKASLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSDQYKNWRRK
LTATLEQMFADEGVNKLIKDLDKRRKAAAKKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcggcg
atgcacggcacgacaacaggaccacaggcggtcgtgccgaatgtgaaggtttataccgcg
ggtaaaaaaatggcgttgccggtagaggggcgcggtgagtttgcctggctgctgactacg
gaagagggcgtgcattacaaagggcgcgtgacgggcggtaaaaaacttaaccttccggct
acattgccggagggctaccacaccctgacgttgacccaggatgaacagcgtacgcactgc
cggattatcgtcgccccgccgcgatgctatgagccgcaggcgctgctggaggggaaaaaa
ctgtggggggcctgcgtccagctttatactctgcgttcagaaaaaaactggggtattggc
gatttcggcgatttgaagtcgatgctggtcgacgtggcgacacgcggcggcgcgtttatc
ggcctgaacccgatccacgcgctttatccggcgaatccggagagcgccagtccctacagc
ccctcgtctcgtcgctggctgaacgtgatatatatcgacgtcaacgccgtcgaagatttc
cgcctgagcgaagaggcgcaggcatggtggcaaatgcccgccacacagcaacagctgcga
caggcgcgcgatgcgcaatgggtcgattacgctaccgttaccgcgctgaaaatcacggcg
ctgcggatggcgtggacgcgctttgccgctcgcgacgatgcgcaaatggcggagtttcgt
cactttatcgcccgcgaaggcgaaagcctttactggcaggcggcattcgacgcgctgcat
gcgtatcaggtgaaagaggatgagcagcgctggggctggccagcctggccggaggcgtac
cagtcggtagagtctcccgctgtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttatctctggcttcagtggctggcctggcgccaattcgccgcctgctgggatacctgc
cagagttttaaactaccgattggtctgtaccgcgatctggcggttggcgtagcggaaggc
ggcgcggaaacctggtgcgaccgggagctgtactgcctgaaagcatctgtcggcgcgccg
ccggatatcctcggcccgctcggtcagaactgggggctgccgccaatggacccgcatatc
attgtcgcccgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgttgcgcattgaccatgtcatgtcgttgctgcgtctgtggtggataccgtatggc
gaaacagcggatcagggggcttacgtccattatccggtagatgatttgctttctattctg
gcgctggagagccaacgtcaccgctgtatggtgataggcgaagatctggggacggtgcca
gttgagattgtcggcaagctgcgcgatagcggggtctattcttataaagtgctgtggttt
gaaaatgaccttgagaaaaacttccgcgcgccaggtgcgtatccgcaacaatcgatggct
gtcgcctcgacgcacgatctccccacgctgcgcggctattgggaatgcggtgacctgacg
ttgggtaaagctctggggctttatccggatgaagtgattctgcgcgggctgtatgaggat
cgcgagcgggcgaaacaggggctattggacgcgctgcataaatatggctgtctgccaaaa
cgcgccgggcataaggcatcgttaatgtcgatgacgccaacgctaaatcgcggacttcag
cgctatatcgccgacagtaacagcggtctattggggcttcagccggaggactggctggat
atggccgatccggttaacgtaccgggcaccagcgatcagtataaaaactggcggcggaag
ctcaccgccacgctggagcagatgtttgccgatgagggcgtaaacaagctgattaaggat
ttggataagcgccgaaaagcggccgcgaagaagaagtaa

DBGET integrated database retrieval system