KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN3544Help
Entry
SEN3544           CDS       T00776                                 

Gene name
rfaG
Definition
lipopolysaccharide core biosynthesis protein
Orthology
K02844  
UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, inner core => outer core => O-antigen
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:set00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3797842..3798966)
Genome map
AA seq 374 aa AA seqDB search
MRVAFCLYKYFPFGGLQRDFMRIAQTVAARGHQVRVYTQSWEGECPDNFELIRVPVKSRT
NHGRNAEYYAWVQHHLRDHPVDRVVGFNKMPGLDVYYAADVCYAEKVAQEKGFFYRLTSR
YRHYAAFERATFEHGKPTQLLMLTNKQIADFQKHYQTEAERFHILPPGIYPDRKYSQQIP
NSRQIYRQKNGISEQQKLLLQVGSDFTRKGVDRSIEALASLPESLRQNTVLYVVGQDKPK
KFAALAERSGVGTNVHFFSGRNDIAELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTT
AVCGYAHYIVDANCGEAMTEPFRQDALNEVLLKALTQPSLRNAWAENARYYADTQDLYSL
PEKAADIITGDLDG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgccttttgcttatataaatattttccttttggcggtctgcagcgtgatttt
atgcgtattgctcaaaccgtggcggcgcgaggtcatcaggttcgtgtttatactcagtca
tgggaaggggaatgcccggataactttgaattaatccgcgtgccggttaaatcccggacg
aaccacggtcgtaacgcagaatattatgcctgggtgcaacaccatttgcgcgaccaccct
gtcgatcgggtggttggattcaataagatgccgggccttgatgtgtattacgccgcagac
gtgtgttacgccgaaaaagtcgcacaggaaaaaggatttttctatcgcctgacatcacgc
tatcggcattatgctgcttttgaacgcgccacgtttgaacacggcaagccgacgcaacta
ttaatgctgacgaataagcagattgctgacttccaaaaacattatcagactgaagcggag
cgtttccatattcttcctccggggatttacccggacagaaaatatagccaacagatccca
aacagtcgtcaaatttatcgtcagaaaaatggtatctcagaacagcaaaaattactgttg
caagtagggtctgactttacccgtaaaggtgtggatcgctctattgaagcgctggcatcg
ctacccgaatctttacggcaaaatacggtgctctatgttgtcgggcaggataagccgaag
aagtttgcagcactggctgaaagaagcggcgtcggcacgaatgtgcattttttctccgga
cgtaatgatatcgcggagttaatggcggcagccgaccttttactgcatccagcctatcag
gaagctgctggtattgttttgctggaagccattactgctggtttgccggtgctgacaacc
gcggtgtgcggttatgcacattatattgtggatgcaaactgtggcgaagcgatgactgaa
ccattccgccaggatgcgctaaatgaggttttactcaaagcgctgacacagccttcctta
cgcaacgcctgggctgaaaatgcgcggtattatgctgatacccaggatttatacagctta
ccggagaaggccgcggatattattacaggtgatttagatggttga

DBGET integrated database retrieval system