KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN3544Help
Entry
SEN3544           CDS       T00776                                 

Gene name
rfaG
Definition
lipopolysaccharide core biosynthesis protein
Orthology
K02844  
UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, inner core => outer core => O-antigen
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SEN3544 (rfaG)
Enzymes [BR:set01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SEN3544 (rfaG)
Glycosyltransferases [BR:set01003]
 Polysaccharide
  Bacterial polysaccharide
   SEN3544 (rfaG)
Lipopolysaccharide biosynthesis proteins [BR:set01005]
 Core region
  SEN3544 (rfaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3797842..3798966)
Genome map
AA seq 374 aa AA seqDB search
MRVAFCLYKYFPFGGLQRDFMRIAQTVAARGHQVRVYTQSWEGECPDNFELIRVPVKSRT
NHGRNAEYYAWVQHHLRDHPVDRVVGFNKMPGLDVYYAADVCYAEKVAQEKGFFYRLTSR
YRHYAAFERATFEHGKPTQLLMLTNKQIADFQKHYQTEAERFHILPPGIYPDRKYSQQIP
NSRQIYRQKNGISEQQKLLLQVGSDFTRKGVDRSIEALASLPESLRQNTVLYVVGQDKPK
KFAALAERSGVGTNVHFFSGRNDIAELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTT
AVCGYAHYIVDANCGEAMTEPFRQDALNEVLLKALTQPSLRNAWAENARYYADTQDLYSL
PEKAADIITGDLDG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgccttttgcttatataaatattttccttttggcggtctgcagcgtgatttt
atgcgtattgctcaaaccgtggcggcgcgaggtcatcaggttcgtgtttatactcagtca
tgggaaggggaatgcccggataactttgaattaatccgcgtgccggttaaatcccggacg
aaccacggtcgtaacgcagaatattatgcctgggtgcaacaccatttgcgcgaccaccct
gtcgatcgggtggttggattcaataagatgccgggccttgatgtgtattacgccgcagac
gtgtgttacgccgaaaaagtcgcacaggaaaaaggatttttctatcgcctgacatcacgc
tatcggcattatgctgcttttgaacgcgccacgtttgaacacggcaagccgacgcaacta
ttaatgctgacgaataagcagattgctgacttccaaaaacattatcagactgaagcggag
cgtttccatattcttcctccggggatttacccggacagaaaatatagccaacagatccca
aacagtcgtcaaatttatcgtcagaaaaatggtatctcagaacagcaaaaattactgttg
caagtagggtctgactttacccgtaaaggtgtggatcgctctattgaagcgctggcatcg
ctacccgaatctttacggcaaaatacggtgctctatgttgtcgggcaggataagccgaag
aagtttgcagcactggctgaaagaagcggcgtcggcacgaatgtgcattttttctccgga
cgtaatgatatcgcggagttaatggcggcagccgaccttttactgcatccagcctatcag
gaagctgctggtattgttttgctggaagccattactgctggtttgccggtgctgacaacc
gcggtgtgcggttatgcacattatattgtggatgcaaactgtggcgaagcgatgactgaa
ccattccgccaggatgcgctaaatgaggttttactcaaagcgctgacacagccttcctta
cgcaacgcctgggctgaaaatgcgcggtattatgctgatacccaggatttatacagctta
ccggagaaggccgcggatattattacaggtgatttagatggttga

DBGET integrated database retrieval system