KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN3562Help
Entry
SEN3562           CDS       T00776                                 

Gene name
gmk
Definition
(GenBank) 5'guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00230  Purine metabolism
set01100  Metabolic pathways
Module
set_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SEN3562 (gmk)
Enzymes [BR:set01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SEN3562 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 AAA_33 MMR_HSR1 AAA_22 ABC_tran AAA_18 Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: CAR35141
Position
3814202..3814825
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVNHD
EFKTMIGREAFLEHAEVFGNYYGTSRETIEQVLATGVDVFLDIDWQGAQQIREKMPQARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALSDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggtacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacactcaggtttccgtttcacatacc
acgcgcgcgccgcgtccgggtgaagtgcacggtgagcactatttctttgtaaatcatgat
gagtttaaaaccatgattggcagggaggcgtttctggagcacgcggaagtgtttggcaat
tactacggcacttcgcgcgaaaccattgagcaagtgctggcaaccggcgttgatgttttt
ctggatatcgactggcagggcgcccagcaaattcgcgaaaagatgccgcaagcacgcagc
atttttattttgccgccatcaaagatcgaattggatcgccgtttacgcggccgcgggcaa
gatagcgaagaagtcattgccaaacgaatggcgcaagcggttgcagaaatgagccattac
gccgaatatgattatcttattgtgaatgacgactttgataccgcgttaagcgacttgaaa
actatcattcgcgctgaacgtctgcgtatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system