KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN3777Help
Entry
SEN3777           CDS       T00776                                 

Gene name
fadB
Definition
(GenBank) large (alpha) subunit of the fatty acid-oxidizing multienzyme complex
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00071  Fatty acid degradation
set00280  Valine, leucine and isoleucine degradation
set00281  Geraniol degradation
set00310  Lysine degradation
set00362  Benzoate degradation
set00380  Tryptophan metabolism
set00410  beta-Alanine metabolism
set00640  Propanoate metabolism
set00650  Butanoate metabolism
set00903  Limonene and pinene degradation
set00930  Caprolactam degradation
set01040  Biosynthesis of unsaturated fatty acids
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01130  Biosynthesis of antibiotics
set01200  Carbon metabolism
set01212  Fatty acid metabolism
Module
set_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SEN3777 (fadB)
   00650 Butanoate metabolism
    SEN3777 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SEN3777 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SEN3777 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEN3777 (fadB)
   00310 Lysine degradation
    SEN3777 (fadB)
   00380 Tryptophan metabolism
    SEN3777 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SEN3777 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SEN3777 (fadB)
   00281 Geraniol degradation
    SEN3777 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEN3777 (fadB)
   00930 Caprolactam degradation
    SEN3777 (fadB)
Enzymes [BR:set01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SEN3777 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SEN3777 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SEN3777 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SEN3777 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAR35353
UniProt: B5QW85
Position
complement(4058149..4060338)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALK
IGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDAVVEAVVENPKVKKAVLAETEQKVRP
ETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLASVSQTKRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGSLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagcctcggc
caggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgctctaat
aaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctcgtcccc
gaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctggaagat
ttacccgtaccgacccttgccgccgtaaacggctatgcgttgggcggcgggtgcgaatgc
gtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccggaaact
aaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctgggcgca
gacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcgctgaaa
atcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgatagcggtg
ttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaactggaa
ccgttgaaactcagtaagattgaagcggcgatgagctttaccatcgctaaaggcatggtc
gcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccattgaagcc
gccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgttccgctg
gcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatatgtaaaa
ggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgtactgggc
gcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccggtcatc
atgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaagctgctg
aacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatttcgacc
atccacccgactctcgattatgccggtttcgatcgcgtagatgctgttgtcgaagcggta
gtcgaaaatccgaaagtgaaaaaagcggtactggcggaaaccgagcagaaagtgcgcccg
gaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagcgccctg
gaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtcgcctgg
gccagcaaaatgggcaagacgccgattgtagtcaacgactgccccggcttctttgttaac
cgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatctg
ctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggcaggcttc
ccacaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgccagccgt
tttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggtaagccg
aagaaagaagaagatgctgcggtggatgacctgctggcaagcgtcagtcagacgaaacgc
gacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaagtggtt
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacagggcagc
gcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaagtgccg
gaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaaccagcc
cgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system