KEGG   Salmonella enterica subsp. enterica serovar Enteritidis: SEN3965Help
Entry
SEN3965           CDS       T00776                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SEN3965 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEN3965 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SEN3965 (aceB)
Enzymes [BR:set01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SEN3965 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4273848..4275449
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
EMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgagctg
gaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgtttt
acgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcagatt
cgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaacgt
aaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcggtg
aacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctggcgg
ggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactataaa
gcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctggcag
gaggcagcctggtggagcgaagtcttcagctacgccgaagaccgctttaacctgccgcgc
ggtacgatcaaagcgaccctgttgattgaaacgcttcctgctgttttccagatggatgag
attcttcatgcgttgcgtgatcatattgtcggtctcaactgtggtcgctgggattatatt
ttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcctgccggacaggcaggtg
gtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgtcac
aagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgttgaa
cgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaacggc
cacgacggcacgtggattgcgcatcctgggttggcggataccgcaatggccgtctttaac
gaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccgatt
accgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgcgcc
aatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgtaccg
atttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttccgc
gaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctacagc
agcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgactta
atcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system