KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN4045Help
Entry
SEN4045           CDS       T00776                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00010  Glycolysis / Gluconeogenesis
set00620  Pyruvate metabolism
set00640  Propanoate metabolism
set00680  Methane metabolism
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01130  Biosynthesis of antibiotics
set01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEN4045 (acs)
   00620 Pyruvate metabolism
    SEN4045 (acs)
   00640 Propanoate metabolism
    SEN4045 (acs)
  Energy metabolism
   00680 Methane metabolism
    SEN4045 (acs)
Enzymes [BR:set01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SEN4045 (acs)
Lipid biosynthesis proteins [BR:set01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SEN4045 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAR35607
Structure
PDB: 

Jmol
Position
complement(4370936..4372894)
Genome map
AA seq 652 aa AA seqDB search
MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYRELHRDVCRF
ANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKSTDSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacacataaacacgccattcccgccaacattgcggatcgttgcctgataaat
ccagagcagtatgagactaaatataaacagtctattaacgaccccgatacgttttggggc
gaacagggaaaaattctcgattggatcacgccgtaccaaaaagtgaaaaacacctccttt
gcgccaggcaatgtgtcgattaaatggtacgaggacggcacgctgaatctggcggcgaac
tgtcttgaccgccatttgcaggaaaatggcgatcgcaccgccattatctgggaaggcgat
gacgcgtcgcagagtaaacatatctcttatcgcgaactgcatcgcgatgtctgccgtttc
gcgaatacgctgctggatctgggcattaaaaaaggcgatgtggtagcgatttatatgccg
atggtgccggaagcggcggtggcaatgttggcctgcgcccgcatcggtgcggtgcattcg
gtgatcttcgggggcttctcgccggaagccgtcgccggacgcattatcgactccagctcg
cggctggtgatcaccgctgacgaaggtgtacgtgccggacgcagtatcccgctgaaaaag
aatgtcgatgacgcgctgaaaaacccgaatgtcactagcgttgagcatgtgatcgtcctg
aagagcaccgacagcgacattgactggcaagaaggccgcgacctgtggtggcgcgatttg
attgaaaaagccagccctgagcaccagcctgaagcgatgaatgccgaagatccgctgttt
atcctttatacctccggctccaccggcaagccgaaaggcgtgctgcacaccaccggcggc
tatctggtctacgccgcgaccacctttaagtatgtctttgattatcaccctggcgatatt
tactggtgtaccgccgatgtgggttgggtgacggggcacagctatctgttgtatggcccg
ctggcctgcggcgcgaccaccttaatgtttgaaggcgtgccgaattggccaacgcccgct
cgcatgtgccaggtggtcgacaaacaccaggtcaacattctttataccgccccgacggct
atccgcgcgctgatggcggaaggcgataaagccattgaaggcaccgaccgttcttcactg
cgcattctgggttccgtcggcgagccgatcaatcccgaagcgtgggaatggtactggaag
aagatcggcaaggaaaaatgtccggtcgtcgacacctggtggcagactgaaacaggcggt
tttatgatcacgccgctaccaggcgctatcgaactgaaagccggttccgccacccgtcct
ttctttggcgtacagcctgcgctggtggataacgaaggccatccgcaagaaggcgcgacg
gaaggcaatctggtcatcaccgattcctggccgggccaggcgcgcactctgttcggcgat
catgaacgttttgagcagacctatttctctacctttaagaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaggacggctattactggatcaccggtcgcgtggatgacgtgtta
aacgtctccggccaccgtctgggtacggcggaaatcgagtcagcgctggtggcgcatccg
aagatcgccgaagcggcggtggtgggtattccacacgctatcaaaggccaggcgatttac
gcttatgtgacgctcaaccacggcgaggagccgtcgccagaactgtacgcggaggtgcgc
aactgggtacgtaaagagattggcccactggcgacgccggacgtgctgcactggaccgac
tcactgccaaaaacccgttccggcaaaattatgcgccgcattttgcgcaaaatcgcggcg
ggcgataccagcaatctgggcgatacctcgactctcgccgatcctggcgtggtggagaaa
ctgctcgaagagaagcaggccatcgcgatgccgtcataa

DBGET integrated database retrieval system