KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN4319Help
Entry
SEN4319           CDS       T00776                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00230  Purine metabolism
set00240  Pyrimidine metabolism
set01100  Metabolic pathways
set03030  DNA replication
set03430  Mismatch repair
set03440  Homologous recombination
Module
set_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SEN4319 (holD)
   00240 Pyrimidine metabolism
    SEN4319 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SEN4319 (holD)
   03430 Mismatch repair
    SEN4319 (holD)
   03440 Homologous recombination
    SEN4319 (holD)
Enzymes [BR:set01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SEN4319 (holD)
DNA replication proteins [BR:set03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SEN4319 (holD)
DNA repair and recombination proteins [BR:set03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SEN4319 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: CAR35871
Position
4644490..4644927
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLAPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttacccctggcgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system