KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_05140Help
Entry
CFSAN001921_05140 CDS       T02737                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:setc00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    CFSAN001921_05140
   01230 Biosynthesis of amino acids
    CFSAN001921_05140
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFSAN001921_05140
   00290 Valine, leucine and isoleucine biosynthesis
    CFSAN001921_05140
Enzymes [BR:setc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CFSAN001921_05140
    2.6.1.66  valine---pyruvate transaminase
     CFSAN001921_05140
Amino acid related enzymes [BR:setc01007]
 Aminotransferase (transaminase)
  Class I
   CFSAN001921_05140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1072861..1074075)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacattcgtggcccc
gttctgaaagaagcgaaacgccttgaggaagaaggtaataaagttcttaaactgaatatc
ggcaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatttgccgacggcgcaaggatattgcgactcgaaagggctttattccgcccgtaaagcg
attatgcagcattatcaggcccgtggaatgcgcgatgtaaccgtggaagatatctatatc
ggtaacggcgtttccgagctgatcgttcaggcgatgcaggcgttgcttaacagtggcgat
gaaatgctggttcccgcgcccgattatccgttatggacagcggcggtatcgctctccagc
ggcaaggcggtacattatctttgcgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaatcaccccacgtacgcgtggtattgtcattattaatccaaacaaccct
actggcgccgtctattctaaagaattgttgatggaaattgtcaacattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagattctctatgacgatgccgagcat
cactctatcgccgcactggcgcctgatctgctgaccatcacctttaatgggttgtctaaa
acctatcgcgtcgccggcttccgccagggctggatggtgctgaacgggccgaaaaaacat
gcgaaaggctatattgaagggctggagatgttagcctcaatgcgcctgtgcgccaacgtc
ccggcgcaacatgctattcagaccgcgctcggcggctatcaaagcattagtgaatttatt
ctgccgggcggtcgactgtatgaacagcgtaaccgcgcctgggagttgattaacgatatt
cccggcgtttcctgcgtaaaaccgcgcggcgcgttgtacatgttccccaggatcgacgct
aaacgttttaatattcacgacgaccagaagatggtgctggacttcctgctacaggaaaag
gtgctgctggtgcaaggtaccgcctttaactggccgtggccagatcacttccgcattgtg
acgctaccgcgtgaagatgacctggagatggccatcaaccgttttgggcgtttcctctca
ggttaccatcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system