KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_07250Help
Entry
CFSAN001921_07250 CDS       T02737                                 

Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:setc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1503085..1504569)
Genome map
AA seq 494 aa AA seqDB search
MKNPTLLQYFHWYYPDGGKLWSELAERADGLNDIGINMVWLPPACKGASGGYSVGYDTYD
LFDLGEFDQKGTIATKYGDKRQLLTAIDALKKNNIAVLLDVVVNHKMGADEKERIRVQRV
NQDDRTQIDDNIIECEGWTRYTFPARAGQYSNFIWDYHCFSGIDHIENPDEDGIFKIVND
YTGDGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQAVAPKPLFIVAEYWSHEVDKLQTYIDQVDGKTMLFDAPLQMKFHEAS
RQGAEYDMRHIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGASYEDSGENGETCRVDMPVINQLDRLILARQRFAHGIQTLFFDHPNCI
AFSRSGTEENPGCVVVLSNGDDGEKTLLLGDNYANKTWRDFLGNRDEYVVTNDQGEATFF
CNAGSVSVWVIEDV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttattgcagtacttccactggtattatcccgacggcggtaaactc
tggtctgagctggcggaacgtgctgatgggctgaatgatatcggtatcaatatggtctgg
ctaccgcccgcctgtaaaggcgcctccggcggctattccgtaggctatgatacctacgac
ctgtttgacctcggcgaatttgaccaaaaaggaactatcgcgacaaagtacggcgataaa
cgccagttactgacggcgatagacgcgctcaaaaaaaataatattgcggtgctgctcgac
gtcgtcgtgaaccacaaaatgggcgcagacgaaaaagaacgtattcgcgttcagcgcgtg
aatcaggatgaccgcacgcaaatcgatgacaacatcattgaatgcgaaggctggacgcgc
tacaccttccctgcccgcgcgggccagtattccaactttatttgggactatcactgtttc
agcggcattgatcacatcgagaatcccgacgaagacggcatttttaagatcgtcaatgac
tataccggcgatggctggaacgatcaggttgatgatgagatgggtaatttcgactatctg
atgggtgaaaatatcgattttcgcaatcatgcggttacggaagagattaaatattgggct
cgttgggtcatggaacaaacccactgtgacggctttcgcctggacgcggtaaaacatata
cccgcctggttttataaagaatggattgagcatgtacaggcggttgcgccaaaaccgctg
tttattgtcgcagaatactggtcgcatgaagtggataaactgcaaacgtacatcgatcag
gtcgacgggaaaaccatgctgttcgacgcgccgttgcagatgaaatttcacgaggcctcg
cgccagggcgcggagtatgacatgcgccacattttcaccggcacgctggtagaagccgac
ccttttcatgcggtgacgctggtcgctaaccacgatacacaaccgttacaggcgctggaa
gcgccggtagaaccctggttcaaaccattggcctatgcgctgatcctgcttcgtgaaaac
ggcgtgccgtcagtgttttatcccgatttatacggcgccagctatgaggatagcggcgaa
aatggcgagacctgtcgggtcgacatgccggtgattaaccaactggatcggctgatcctc
gctcgtcagcgttttgcgcacggtatacaaacactctttttcgatcatcctaactgtatc
gcctttagtcgcagcggtactgaagagaatccaggctgtgtggtcgtactttccaatggc
gacgacggtgaaaaaaccctcctgctcggcgacaattacgctaacaagacctggcgtgat
tttctgggaaaccgggatgagtatgttgtaactaatgatcaaggcgaagcgacgttcttc
tgcaacgcaggcagcgtcagcgtgtgggtcattgaggacgtgtga

DBGET integrated database retrieval system