KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_08110Help
Entry
CFSAN001921_08110 CDS       T02737                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:setc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CFSAN001921_08110
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFSAN001921_08110
   00330 Arginine and proline metabolism
    CFSAN001921_08110
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CFSAN001921_08110
Enzymes [BR:setc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     CFSAN001921_08110
Exosome [BR:setc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CFSAN001921_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1664089..1665414)
Genome map
AA seq 441 aa AA seqDB search
MYHGQLKNILLLSLRFIMDKLSYASDSSTSAWNTYLQQIERVAPYLGELSPWVDTLRHPK
RALIVDIPVQMDDGTIRHFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCA
ALNLPYGGAKGGIRVDPFSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVGTNGKVMAW
MMDTYSMNHGTTVTGVVTGKPIHLGGSLGREKATGRGVFVSGLEAARRANIAVEGARVAV
QGFGNVGSEAARLFAGAGARVVAIQDHTATLFNATGIDMKALTAWQTEHKQIAGFPGAET
IASDAFWRLEMDILIPAALEGQITRQRAEALTCKLVLEGANGPTYPDADDVLASRGILVV
PDVVCNAGGVTVSYFEWVQDMASFFWSEEEINARMDKIMTDAIVHVWEKAAEKSCSLRTA
AYIVACERILLARKDRGIYPG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacggtcaattaaagaacatattacttttatcactaaggtttatcatggataag
ttatcttacgcttcagatagcagcacatctgcctggaatacctacctgcaacaaatcgag
cgtgtggccccttatctgggcgagttatccccctgggtggatactctgcgccacccaaaa
cgcgctctgatcgtcgatattccggtacaaatggatgatggcactattcgtcatttcgaa
ggatatcgcgtgcagcacaacctctcccgaggtccgggtaaaggcggtgttcgctaccat
cctgacgttgatctcaatgaagtgatggccctgtcagcatggatgaccatcaaatgtgcc
gcgctgaacctgccatacggcggcgctaaaggcggtatccgcgtcgatccgttctcgctg
tcggaaggtgaactggagcgtttgacccgccgctataccagcgagatcggcattatcatc
gggccgcagaaagatattcctgcgccggatgtcggcaccaacggtaaagtgatggcctgg
atgatggatacgtattccatgaatcatggcacgacggtcactggcgtcgtcaccggtaag
cctatccatcttggcggttcgctgggccgtgaaaaagcgacggggcgcggcgttttcgtc
agcgggctggaagccgcacgtcgggcgaatattgctgttgaaggcgctcgcgttgcggtt
cagggttttggtaacgtcggcagcgaagccgcgcgtctgtttgcaggcgctggcgcccgt
gtcgtggcgattcaggatcataccgcgaccctgtttaacgccaccggtattgacatgaag
gcgctcacggcatggcagacagaacacaaacagatagccggtttcccgggcgcggaaact
atcgccagcgatgcgttctggcgtctggagatggatattctgatcccggcggcgcttgaa
ggtcagataactcgtcagcgcgcggaagccctgacgtgtaagctggtgctggaaggggct
aacggcccaacctatccggatgctgatgatgttctggccagccgtggtatccttgtggtg
cctgacgtggtctgtaacgcaggcggcgtaaccgtcagctacttcgaatgggtacaagat
atggccagcttcttctggagcgaagaagagatcaatgcgcgcatggacaaaatcatgacc
gacgcgattgtccatgtctgggagaaagcggctgagaaatcctgctctctgcgcaccgca
gcctatattgtcgcctgtgagcgcattctgctggcccgtaaagatcgcggtatctatcca
ggttaa

DBGET integrated database retrieval system