KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_24190Help
Entry
CFSAN001921_24190 CDS       T02737                                 

Definition
DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Brite
Enzymes [BR:setc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CFSAN001921_24190
Secretion system [BR:setc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CFSAN001921_24190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
unnamed:79923..80630
Genome map
AA seq 235 aa AA seqDB search
MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVELPIKGVRAVQSDGQIMFLSE
NGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKSMGMDVDTLNTVSMGRGDKEVVVFV
DPRCAVCHQLMGDAKSLVDDYTFKFIVIPALGAESNRLAKNLYCAKDKTHALDALMNNTL
GSLPSKETCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKGRPKNLKSWLESAE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaaaattacttggggcgctgatggtgttcgggattattaccggcacggctcat
gcgtcatcgaaattggaaatcaccgatcccagagcggcgaagatagaggacattgtagag
ctacccatcaaaggggttcgagccgtccaaagtgatgggcagatcatgttcctctctgaa
aacggacgatttgttatttcaggacaaatctacgacctgtggagcaagaagcccctcaac
acgatgtcccaaatgagggatgtagcggagcgtatccacttcaagagcatgggcatggat
gtggacacgctgaacactgtgtcgatggggcgtggtgacaaagaggtggtggtctttgtt
gatcctaggtgcgcggtttgccatcagctcatgggtgatgccaaatcgctggtggatgat
tacacctttaaatttatcgtgattccagctctgggtgctgagtccaaccgcctggcaaaa
aacttgtactgcgcgaaagacaaaacccacgcgcttgatgcgctgatgaacaacaccctg
ggttcccttccttcaaaagaaacctgcgaccccggccaatacgaccaaacgctgctgaca
gctcatttcattgggattgagggcgttccgttcgttgttgctccggatggtcgtgtcagc
aaaggacgtccgaagaacctgaaatcatggttggagagtgctgaatga

DBGET integrated database retrieval system