KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_02915Help
Entry
STU288_02915      CDS       T02639                                 

Gene name
katE
Definition
hydroperoxidase II (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:setu00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:setu00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(612387..614639)
Genome map
AA seq 750 aa AA seqDB search
MSHNEKSPHQSPVHDTRESQPGLDSLAPSDGSHRPTPETTPPGAQPTAPGSLKAPETAND
KLTALDAFRKGSENYALTTNQGVRIADDQNSLRAGSRGPTLLEDFILREKITHFDHERIP
ERIVHARGSAAHGYFQPYKDLSDITKAAFLCDPQKITPVFVRFSTVQGGAGSADTVRDIR
GFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYV
SLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAQGKATFVRFHWKPLAGKASLV
WDESQKLTGRDPDFHRRDLWEAIEAGDFPEYELGLQLIAEEDEFKFDFDLLDPTKLIPEE
LVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGIDFTNDPLLQGRLFSYTDTQISRL
GGPNFHEIPINRPTCPYHNFQRDGMHRMDIDTNPANYEPNSINDNWPRETPPAPKRGGFE
SYQERVDGNKIRERSPSFGEYYSHPRLFWLSQTPIEQQHIIDAFSFELGKVARAYIRERV
VDQLAHIDVTLAQGVAHNLGFALTHEQTQIAPPPDVNGLKKDPALSLYAVPDGDVKGRVV
AILLNDKVNAAELLTILQALKAKGVHAKLLYSRMGEVTADDGSTLTIAATFAGAPSLTVD
AVIVPCGNIADIESCGDARYYLLEAYKHLKPIALAGDARRFKALLNIDSQGEEGLVEADN
VDHHFMDTLLTLMAAHRVWSRAGKINAIPA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataatgagaaatccccccatcagtcccccgtgcatgatacccgtgaatcacag
cccggcctggactccctggcgccgtcagacggttcacatcgccccacgccagaaacgacg
ccgccgggcgcgcaaccgacggcccccggcagcttaaaagcgcccgagaccgcgaatgat
aagctcactgccctcgacgcctttcgtaaaggcagcgaaaattatgcgctgaccaccaat
cagggcgtgcgcatcgccgacgatcaaaattctcttcgcgccggcagccgcggccctacg
ctgttggaagattttatcctgcgcgagaaaattacccactttgaccatgagcgcatcccg
gagaggatcgttcacgcccgcggatctgcagcgcacggctatttccagccatataaagac
ctgagcgacatcacgaaagccgcgtttctgtgcgatccacagaaaattaccccggtcttt
gttcgcttttcgacagtacagggcggcgcggggtctgctgataccgtacgtgatatccgc
ggttttgcgaccaaattttataccgaagagggaattttcgatctcgtcggtaataacacg
ccgatcttttttatccaggatgcgcataagtttccggattttgtgcacgccgttaagccc
gaaccacattgggctattccgcaagggcagagtgcgcacgacaccttctgggactatgtt
tccttacagcctgagacgctgcacaacgtcatgtgggcaatgtcggatcgcggtattcca
cgcagttatcggacgatggaagggttcggcattcacaccttccgtctgatcaatgcacaa
gggaaagcgacctttgtccgtttccactggaaaccgttggcaggtaaagcctcgctggta
tgggatgagtcacaaaaactgaccggtcgcgatccggattttcaccgccgggatctgtgg
gaggccatcgaagcgggcgatttcccggaatacgagctgggcctacaactcattgccgaa
gaggatgaatttaaattcgattttgatctgctcgatccgaccaaactgattccggaagag
ttggtgccagtacaacgcgtcggcaaaatggtgttaaaccgtaatccggataactttttc
gctgaaaacgaacaggcggcatttcatccaggacatattgttcccggcattgattttacc
aacgatccgctgttacaggggcgtctgttctcttataccgacacgcaaatcagtcgtctg
ggcgggccaaacttccacgaaattccgattaaccgccctacctgcccctaccataacttc
cagcgtgacggtatgcaccggatggatatcgacaccaatccggcgaactatgaaccaaac
tccattaatgacaactggccacgcgaaacgccgccagcgccaaaacgcggcggcttcgaa
tcataccaggaacgcgtggatggcaataaaatccgcgaacgcagcccctctttcggtgaa
tattactcgcatcctcgcctgttctggctcagtcagacgccgatagaacagcagcatatt
attgacgcgttcagctttgaactgggtaaagtcgcccgcgcgtatattcgggagcgggtg
gtcgatcagttagcgcatattgatgtcacgctggctcagggcgtcgcgcataatctcggt
tttgcactcacccatgagcaaacgcaaattgccccgcctcctgatgtcaacggtctgaaa
aaagatccggcgctcagcctgtatgcggtgccggacggcgatgttaaaggccgagtggtc
gctattctgctgaacgacaaagttaacgccgccgaactgttgaccattttgcaggcttta
aaagccaaaggcgtccacgcaaaactgctctattcacggatgggtgaagtaacggctgat
gatggttcaacattaacgattgcggcaacctttgccggcgcgccgtcgctaacggtcgat
gcggtaatagtaccgtgcggcaatattgccgatatcgagagttgcggcgatgcccgttac
taccttctggaagcctacaaacatctgaagcccatcgcactggcaggcgacgcccgacgg
tttaaggcgcttttaaacattgatagccagggggaagaaggacttgttgaggcagataac
gttgaccaccactttatggacactctgctgacgctgatggcggcacaccgtgtctggtcg
cgtgcggggaaaattaacgcgattcctgcataa

DBGET integrated database retrieval system