KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_03945Help
Entry
STU288_03945      CDS       T02639                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu00220  Arginine biosynthesis
setu00250  Alanine, aspartate and glutamate metabolism
setu00471  D-Glutamine and D-glutamate metabolism
setu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:setu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STU288_03945
   00220 Arginine biosynthesis
    STU288_03945
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    STU288_03945
Enzymes [BR:setu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     STU288_03945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGK08401
Position
817919..818845
Genome map
AA seq 308 aa AA seqDB search
MARAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccagggccatggataatgcaattttagagacgattttacagcgcgttcgccccctc
attggccagggcaaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaag
ctggggatagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaa
cgcttctctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattat
ccggaagaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcg
ttggttcagttagagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcg
ctggtggtatgcgacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaa
gttgtgcgcgcgctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctct
gaatttgagcattccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaat
tttcatcatgatgtgcctaccgtgttgcaaaattactttcactactgtgcgttgaaaatg
agctgcatggaactggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcat
ctcgacgagccggtagtgacccccatgcaggcccggcagattaatgcgctaatggcgacc
agcgggatgtatcagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatcc
ggcgtgggcggcggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system