KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_13740Help
Entry
STU288_13740      CDS       T02639                                 

Definition
(RefSeq) phage lysozyme
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Brite
Enzymes [BR:setu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     STU288_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2857752..2858261)
Genome map
AA seq 169 aa AA seqDB search
MNPSIVKRCLVVAVLAIAATLPGFQSLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVVPGKTITERQAAQGLITNVLRVERALDKCVVQPMPQKVYDAVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACHQLPRWVYVKGVFNQGLDNRRAREMTWCLKGV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcaatcgttaagcgctgccttgtcgtggcggtgctggctatcgccgccacg
ctgcccggatttcagtcgcttcatacctccgttgaggggctgaaactgatcgccgattac
gagggatgccgcctgcagccttatcagtgcagcgcgggcgtctggactgacgggatcggc
aatacgtccggtgtggtgcctggaaaaaccatcacggaacggcaggcggcgcagggactt
atcaccaacgtgctgcgcgtggagcgggcactggataaatgtgtggtacagccgatgccg
caaaaggtctatgacgcggtggtgtcgtttgctttcaacgtgggcaccggcaacgcctgc
agctccacgctggttaagttgctgaaccagcggcgctgggcggatgcctgccatcagctg
ccgcgctgggtatatgtcaaaggtgtgtttaatcaggggctggacaaccgccgcgcgcgg
gaaatgacctggtgcttaaaaggagtatag

DBGET integrated database retrieval system