KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_18270Help
Entry
STU288_18270      CDS       T02639                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:setu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STU288_18270
Enzymes [BR:setu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     STU288_18270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3792314..3793420)
Genome map
AA seq 368 aa AA seqDB search
MTMLRGWITMLVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSYA
MFFALAANDRPAFAQLFNWTQNNLAQGSLREYLPAWLWGQKDPDTWSVLDSNSASDGDIW
MAWSLLEAGRLWKETRYTEVGTALLKRIAREEVLNVPGLGSMLLPGKIGFAEANSWRFNP
SYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLIS
SYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVGF
SAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPDW
GQECVSSR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgactatgctgcgcggatggataacgatgctcgtcatgctgacggcaataaatgcgcag
gcagcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcaggga
cgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctacgcc
atgttctttgccctggcagcgaacgatcgaccggcgttcgcgcaactgtttaactggacg
caaaacaatctggcgcagggatcgttgcgtgaatatctgcccgcctggctgtgggggcaa
aaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatctgg
atggcatggtcgctgctggaggccggtcgtctgtggaaagagacgcgttataccgaggtg
ggcacggcgttgctaaaacgcatcgcccgcgaagaggtcctgaatgtgccggggctgggc
tcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaaccca
agctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcgacg
ttacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccggac
tgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatcagt
agctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgatggcgatccgcaa
aaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggcgtt
ccaccggagaaagtggatgtcgtcagcgggaatgcgcaagggacggggccggtcgggttt
tccgccgccttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacagcgg
gtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctctttgga
caaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgactgg
ggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system