KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_19655Help
Entry
STU288_19655      CDS       T02639                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:setu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STU288_19655
Enzymes [BR:setu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     STU288_19655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4090508..4091437
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLIVLGSINADHILNLESFPTPGETVTGSHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGDSIRKQLVSDRIDIAPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVDAQRERIAQADALLMQLESPLESVLAAAKIAHQHHTTVALNPAPARELPDELLAL
VDIITPNETEAEKLTGVRVENDDDAAKAAQVLHDKGIRTVLITLGSRGVWASVDGEGRRV
PGFSVEAVDTIAAGDTFNGAFITAILEETPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLHQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggtaatctcatcgtccttggcagcattaatgccgatcatatccttaat
cttgagtccttccctaccccgggtgaaacggtaaccggtagccattatcaggtcgcgttt
ggtgggaaaggcgcgaatcaggcggttgctgcgggacgtagcggggcaaatattgcgttt
atcgcctgcacgggcgatgacgatattggcgacagtattcgtaaacaattagtcagcgat
cgtattgatatcgcgccagttagcgttattaaaggcgagtctaccggggtggcgctgatt
ttcgttaatggcgaaggcgagaacgtcatcggtattcatgccggagcgaatgccgcgtta
tcgccggcgttggttgatgcgcagcgtgaacgtatcgcgcaggcggatgcgttactgatg
caactggaatcgccgctggaaagcgtactggcggcggcgaaaatcgcccatcaacatcat
actactgttgcgcttaatccggcgcctgcccgtgagttaccggatgaactgctggcgctg
gtggacatcatcacgccaaatgaaacggaagctgaaaagctgacgggcgtgcgtgtggaa
aatgacgacgatgccgcgaaagctgcgcaggttttgcatgataaaggcattcgaaccgta
ttaattaccttaggaagccgtggcgtctgggccagcgtagacggcgagggccgccgcgtt
cctggatttagcgttgaggctgtcgataccattgctgccggagatacgtttaacggcgcc
tttatcaccgcgatactggaggagacgccgttgccggaagcgattcgctttgcccatgcc
gccgccgcgattgccgtaacgcgtaaaggcgcgcaaccttccgttccgtggcgcgaagag
atagaagcgtttttacatcagcaggggtaa

DBGET integrated database retrieval system