KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_21585Help
Entry
STU288_21585      CDS       T02639                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:setu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:setu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:setu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4537277..4538632
Genome map
AA seq 451 aa AA seqDB search
MMTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSA
GASGRITCHTNQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWRICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTA
EELARDLNIDPTSLRYRCAGINHMAFYLELERKTADGTYVNLYPELLAAYDAGQAPKPNI
HGNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCV
EQLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGS
CVEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaat
atcctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggat
attgacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcg
ggcgcttctggccggattacctgccataccaaccagaaagcggcgctacaggatgcggat
ttcgtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgag
gtttgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatc
atgcgcgcgctgcggaccatcccgcatctgtggcggatttgcgaagacatgacggaagtc
tgtccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatg
tatgcccgttatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcg
gaagaactggcgcgcgacctgaatatcgatcccacctcgctgcgctaccgctgcgccggc
attaaccacatggcgttttacctcgaactggagcgcaaaacggctgacgggacttatgtc
aatctctatcctgaattgctggcggcctatgacgccggacaggcgccgaagcccaatatt
cacggcaatgaacgctgccagaacatcgtgcgctatgagatgttcaaaaagttgggctac
ttcgtcactgagtcatcagagcattttgccgagtacacgccgtggtttattaaaccggga
cgcgaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgta
gaacaactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgac
atcaaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccg
agcgtgatttacggcaatgtgcgtaacgaggggctgattgataacctgccgcagggaagc
tgcgtggaagtggcttgtctggtggatgccaacggcattcaaccgacgaaggtggggacg
atcccttcccatctggcggcgatgatgcagaccaacatcaacgtgcaaacgctgttgacc
gaagccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcat
accgcagcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcg
catggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system