KEGG   Streptococcus equi subsp. equi 4047: SEQ_0045Help
Entry
SEQ_0045          CDS       T00877                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SEQ_0045
Enzymes [BR:seu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SEQ_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56643..57695
Genome map
AA seq 350 aa AA seqDB search
MKAATYVAPGQLELIDQPKPEILAPTDAVVRLLKTTICGTDLHILGGDVPETTHGTILGH
EGIGIVESVGSAVNNFKVGDKVIISCITACNTCYYCKKGIPAHCESGGWILGHLINGTQA
EYVHIPQADGSLYHAPKTVEDDALVMLSDIFPTSYEIGVQSAKVKPGDTVCIVGAGPIGL
AALLTAQFYSPAKLIMVDLSESRLEAAKRFGATDTICSGDLDDIVKKVHELTDGRGVDVA
IECVGYPATFDICQKIIAIGGHVSNVGVHGKPVSLDLQDLWIKNITMSTGLVNANTTEML
LNVLKSGKIDATKMVTHHFKLSEVEKAYEVFKNAGSNNALKVIIENDITA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctacatatgttgctccaggtcagctggagcttattgatcaaccaaaacca
gagattcttgctccgacagatgctgtggttcgtttattgaaaacaacaatctgtggaaca
gacttacatattttaggtggagatgtcccagagactactcatggtaccattttaggtcat
gaaggtattggtattgtcgagtcagtcggctctgcagtgaacaactttaaggtaggtgat
aaggttattatttcctgtatcacagcctgtaatacctgctattattgtaaaaaaggaatt
cctgctcattgtgaaagcggtggctggattctagggcatttgattaatgggacacaagca
gagtatgttcatattcctcaagcagatggcagtctttatcatgctcctaaaaccgttgag
gatgatgccttggttatgctgtcagacattttcccaacttcctatgaaataggcgttcag
tctgcaaaggtaaagccgggtgatacagtgtgtatcgttggagcaggtcctatcggacta
gcagctcttttaacagcacaattttattcaccagctaagctgatcatggttgacttgtca
gaatcacgtttagaagcagctaagcgctttggagcaacagatacgatttgctctggtgac
cttgatgatattgtcaaaaaagtccatgaattaactgatggtcgaggtgttgatgttgcc
attgagtgtgtaggctatcctgctacctttgatatttgccaaaagattattgctattggc
gggcatgtttctaacgttggtgtccatggaaaaccagttagtttggacctacaggaccta
tggatcaaaaacattacaatgtcaactggcctagtaaacgctaatacaacagaaatgcta
ttgaatgtgttgaaatctggtaagattgatgcaactaagatggtaacacatcactttaag
ctgtcagaggttgaaaaagcctatgaggtctttaaaaatgccggcagtaataacgccctt
aaagtgattattgaaaatgacattacagcctaa

DBGET integrated database retrieval system