KEGG   Streptococcus equi subsp. equi 4047: SEQ_0046Help
Entry
SEQ_0046          CDS       T00877                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SEQ_0046
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_0046
  Lipid metabolism
   00071 Fatty acid degradation
    SEQ_0046
  Amino acid metabolism
   00350 Tyrosine metabolism
    SEQ_0046
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SEQ_0046
   00626 Naphthalene degradation
    SEQ_0046
Enzymes [BR:seu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SEQ_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57898..58914
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcgcatggtgattttggtcaggttccagggcgtatcctcggtcatgaa
ggtatcggtattgtcgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcattgtgaatattgtacaacaggtcgc
gagactctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgttacagctgactatgctgtgaaagtgccagatggtcttgacccagctcaa
gcatcatcaattacctgtgcaggcgttacaacctataaggctatcaaagaagcaggtgcc
gctccaggacaatggattgttatctttggtgccggtggacttggtaacctagctgttcag
tatgctaaaaaggttttcaatgctcatgtcgtagcagtggacattaacaatgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gccggctatatccaagaaaaaacaggtggtgctcatggcgttgtggtaaccgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctatcgtaaagactgtcctagacggaatcaag
gtagtcggatcacttgtgggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgtgccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggtctcattcaaggaagaaaggtattggatttcacgctttaa

DBGET integrated database retrieval system