KEGG   Streptococcus equi subsp. equi 4047: SEQ_0052Help
Entry
SEQ_0052          CDS       T00877                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00260  Glycine, serine and threonine metabolism
seu00750  Vitamin B6 metabolism
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01230  Biosynthesis of amino acids
Module
seu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEQ_0052
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SEQ_0052
Enzymes [BR:seu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SEQ_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAW91961
UniProt: C0MBH9
Position
65158..66642
Genome map
AA seq 494 aa AA seqDB search
MPMMYQSTRNAANKVTASQAILSGLADDGGLFTPTSMPVLDLDFEELKTKSYQEVAKLIL
SAFFDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELFHGSTIAFKDMALSILP
YLLTTAAKKQGVERKIAILTATSGDTGKAAMAGFVDVPGTDIIVFYPKSGVSRIQELQMI
TQAGHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQLSSANSMNIGRLIPQVVY
YIYAYAQLVRHQRLEAGETINIVVPTGNFGNLLVAYYAKEIGLPVAKFICASNENNVLTD
FFASGRYDKKRPFKVTTSPSMDILVSSNLERLVFYLLGNDAQKTAVLMKSLAETGQYQLA
DADQSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHTAVASAVYRAYREQSGDSRPTI
VASTASPYKFPRVVVEAISGQQVASDFEALEQLADISGVVVPQAVNGLQEAPIRHSLLVT
VADMQQAVEAYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgatgtaccaatcaacaagaaatgcagctaataaggtaacagctagtcaagcg
attttaagtggcctagcagatgatggtggcttgtttactcctacaagcatgccagtgctg
gatctagattttgaggagctaaagaccaagtcctatcaagaggttgccaagcttatttta
tcagccttttttgatgactatactgaagcagaattagatgcttgtatctcttctgcctat
gatgataagtttgatacagcagtgatagcacctctagctacgttaaaggattatcataat
ttggagctatttcatggctcaaccatcgcatttaaggacatggctctatctattttgcct
tatctcttgacaactgctgctaaaaagcaaggtgtggagcgaaaaattgcgattttaacc
gctacctcaggtgatactggtaaggcagcaatggcaggctttgttgatgttccgggaacg
gatattattgtcttttatcctaagtcaggcgttagcaggattcaggagctgcagatgatc
acacaggccggtcacaatacccatgttgtggcgattgaaggcaattttgatgatgctcaa
acagaggtcaagcgcctgtttaatgaccctgatttgcgtgagcggctagcagctcaacag
atacagctgtcttcggccaattcgatgaatattggtcgtttgattcctcaggttgtctat
tatatttatgcttatgcccagttggtaaggcatcagcgacttgaagctggagagacgatt
aacatagtagtgccgacaggaaattttggcaatctactggttgcctactacgccaaagaa
attggacttcctgttgccaaattcatctgtgcttccaatgaaaacaatgtcttgacagat
ttctttgctagtggtaggtatgataaaaagcgtcccttcaaggtgactactagtccatca
atggatattttggtgtcttcaaatttagagcgcttggttttttatttactaggcaatgat
gcccaaaagacagcagtattaatgaagagcttggcagaaacaggtcagtatcagctagct
gatgcagatcagtctatccttgatttatttgcggcaggctttgcaacagagcaagagact
gctaaagagatcaaaacgatatttgagtctgatcattatgtgcttgacccacatacagct
gtagcttcagctgtttatcgtgcttatcgggagcaatcaggtgactctagaccgactatt
gttgcgtcaactgctagtccttataagtttccgcgggtagttgtggaagctattagtggt
cagcaggttgccagtgattttgaggcgcttgagcagttggctgatatatcaggtgtagtc
gtgccacaagcggtcaatggcttacaggaggcgcccattcgtcatagccttttagtgaca
gtagcagatatgcagcaggcagtagaggcttatcttggagtatag

DBGET integrated database retrieval system