KEGG   Streptococcus equi subsp. equi 4047: SEQ_0052Help
Entry
SEQ_0052          CDS       T00877                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SEQ_0052
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEQ_0052
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SEQ_0052
Enzymes [BR:seu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SEQ_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65158..66642
Genome map
AA seq 494 aa AA seqDB search
MPMMYQSTRNAANKVTASQAILSGLADDGGLFTPTSMPVLDLDFEELKTKSYQEVAKLIL
SAFFDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELFHGSTIAFKDMALSILP
YLLTTAAKKQGVERKIAILTATSGDTGKAAMAGFVDVPGTDIIVFYPKSGVSRIQELQMI
TQAGHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQLSSANSMNIGRLIPQVVY
YIYAYAQLVRHQRLEAGETINIVVPTGNFGNLLVAYYAKEIGLPVAKFICASNENNVLTD
FFASGRYDKKRPFKVTTSPSMDILVSSNLERLVFYLLGNDAQKTAVLMKSLAETGQYQLA
DADQSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHTAVASAVYRAYREQSGDSRPTI
VASTASPYKFPRVVVEAISGQQVASDFEALEQLADISGVVVPQAVNGLQEAPIRHSLLVT
VADMQQAVEAYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgatgtaccaatcaacaagaaatgcagctaataaggtaacagctagtcaagcg
attttaagtggcctagcagatgatggtggcttgtttactcctacaagcatgccagtgctg
gatctagattttgaggagctaaagaccaagtcctatcaagaggttgccaagcttatttta
tcagccttttttgatgactatactgaagcagaattagatgcttgtatctcttctgcctat
gatgataagtttgatacagcagtgatagcacctctagctacgttaaaggattatcataat
ttggagctatttcatggctcaaccatcgcatttaaggacatggctctatctattttgcct
tatctcttgacaactgctgctaaaaagcaaggtgtggagcgaaaaattgcgattttaacc
gctacctcaggtgatactggtaaggcagcaatggcaggctttgttgatgttccgggaacg
gatattattgtcttttatcctaagtcaggcgttagcaggattcaggagctgcagatgatc
acacaggccggtcacaatacccatgttgtggcgattgaaggcaattttgatgatgctcaa
acagaggtcaagcgcctgtttaatgaccctgatttgcgtgagcggctagcagctcaacag
atacagctgtcttcggccaattcgatgaatattggtcgtttgattcctcaggttgtctat
tatatttatgcttatgcccagttggtaaggcatcagcgacttgaagctggagagacgatt
aacatagtagtgccgacaggaaattttggcaatctactggttgcctactacgccaaagaa
attggacttcctgttgccaaattcatctgtgcttccaatgaaaacaatgtcttgacagat
ttctttgctagtggtaggtatgataaaaagcgtcccttcaaggtgactactagtccatca
atggatattttggtgtcttcaaatttagagcgcttggttttttatttactaggcaatgat
gcccaaaagacagcagtattaatgaagagcttggcagaaacaggtcagtatcagctagct
gatgcagatcagtctatccttgatttatttgcggcaggctttgcaacagagcaagagact
gctaaagagatcaaaacgatatttgagtctgatcattatgtgcttgacccacatacagct
gtagcttcagctgtttatcgtgcttatcgggagcaatcaggtgactctagaccgactatt
gttgcgtcaactgctagtccttataagtttccgcgggtagttgtggaagctattagtggt
cagcaggttgccagtgattttgaggcgcttgagcagttggctgatatatcaggtgtagtc
gtgccacaagcggtcaatggcttacaggaggcgcccattcgtcatagccttttagtgaca
gtagcagatatgcagcaggcagtagaggcttatcttggagtatag

DBGET integrated database retrieval system