KEGG   Streptococcus equi subsp. equi 4047: SEQ_0271aHelp
Entry
SEQ_0271a         CDS       T00877                                 

Gene name
hasC1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SEQ_0271a (hasC1)
   00052 Galactose metabolism
    SEQ_0271a (hasC1)
   00500 Starch and sucrose metabolism
    SEQ_0271a (hasC1)
   00520 Amino sugar and nucleotide sugar metabolism
    SEQ_0271a (hasC1)
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SEQ_0271a (hasC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257131..258039
Genome map
AA seq 302 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAPQG
KAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILENQAPGAGNEVQLTDAIDK
LNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIKLGKALESTQQQ
TK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtcagaaaagccattatcccagccgccggcctaggcacccgcttcctgcct
gccactaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagccctaaaggccggtatcgaggagattcttgtcgtcaccggcaaggcc
aaacgctctatcgaagaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctgctcaagctcgttgatgagaccactgccatcaacctgcacttc
attcgtcagagccaccctagaggactaggggacgctgtcctccaagccaaggcctttgtg
ggcaatgagccctttgtggtcatgctaggagacgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagcttatcgaggattatgactgtacacacgcctcaacgatt
gctgtgatgagggttccgcatgaggaggtttccaattatggcgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtcctgatgag
gcacctagtgacttagcgattattggacgttatttgttgacgcctgagatttttgccata
ttggagaatcaggcgcctggggctggcaatgaggttcagctgaccgatgcgattgacaag
ctcaacaagactcagcgggtttttgccagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactatgctctcaagcaccctcaggtcaag
gacgacctcactgactacattataaagctgggtaaagcactagaaagcactcaacagcag
acaaaatag

DBGET integrated database retrieval system