KEGG   Streptococcus equi subsp. equi 4047: SEQ_0289aHelp
Entry
SEQ_0289a         CDS       T00877                                 

Gene name
gtaB2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SEQ_0289a (gtaB2)
   00052 Galactose metabolism
    SEQ_0289a (gtaB2)
   00500 Starch and sucrose metabolism
    SEQ_0289a (gtaB2)
   00520 Amino sugar and nucleotide sugar metabolism
    SEQ_0289a (gtaB2)
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SEQ_0289a (gtaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(272684..273586)
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPTAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAPQG
KAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILENQAPGAGNEVQLTDAIDK
LNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIKLSKQLNKDVKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtcagaaaagccattatcccaaccgccggcctaggcacccgcttcctgcct
gccactaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagccctaaaggccggtatcgaggagattcttgtcgtcaccggcaaggcc
aaacgctctatcgaagaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctgctcaagctcgttgatgagaccactgccatcaacctgcacttc
attcgtcagagccaccctagaggactaggggacgctgtcctccaagccaaggcctttgtg
ggcaatgagccctttgtggtcatgctaggagacgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagcttatcgaggattatgactgtacacacgcctcaacgatt
gctgtgatgagggttccgcatgaggaggtttccaattatggcgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtcctgatgag
gcacctagtgacttagcgattattggacgttatttgttgacgcctgagatttttgccata
ttggagaatcaggcgcctggggctggcaatgaggttcagctgaccgatgcgattgacaag
ctcaacaagactcagcgggtttttgccagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactatgctctcaagcaccctcaggtcaag
gacgacctcactgactacattataaagctcagtaagcaactgaacaaggacgtcaagaaa
tag

DBGET integrated database retrieval system