KEGG   Streptococcus equi subsp. equi 4047: SEQ_0300Help
Entry
SEQ_0300          CDS       T00877                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:seu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SEQ_0300 (gltX)
Enzymes [BR:seu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SEQ_0300 (gltX)
Amino acid related enzymes [BR:seu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SEQ_0300 (gltX)
Transfer RNA biogenesis [BR:seu03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SEQ_0300 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284564..286009
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFIIRIEDTDRKRHVEDGERSQL
ENLKWLGIDWDESPETHERYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYVNEYLGMSAYEKAAYIAEREAAGIVPTVRLAVNEAGVYKWTDMVKGDIVFEG
GNVGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPV
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEAEIFSR
EQLIALFDEIRLSKSPAAFDQKKMDWMSNEYFKHADLGAVYALCKPFLEAAGRLTEKAEK
LVELYQPQLSSADEIVPLTDLFFSDFPELTAKEKEVMAAETVPTVLKAFKEKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREQSIEHIANM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgctatgcaccaagcccaacaggccttttacatatcgga
aatgcgcggacagcgctctttaactatctttatgctcgtcatcatggcggtgactttatt
attcgtattgaagatactgatcgtaagcgtcatgtcgaggacggcgagcgttctcagctg
gaaaatttaaaatggcttggtatagattgggacgaaagtcctgagacgcacgagcgttat
cgtcagtcagagcgtctagccctttatcaacaatacattgaccaattattggcagaaggc
aaggcttacaagtcttatgtgactgaggaggagctggcagcagagcgtgagcgtcaagag
gcagctggtgaaacacctcgctatgtcaatgaataccttggcatgtcagcatatgaaaag
gcggcctatattgcagagcgtgaagcagcaggtattgtgcctacggttcgtttagcggtc
aatgaggctggtgtttacaaatggacagacatggtaaaaggcgatatcgtatttgagggt
ggcaatgtcggtggtgactgggtaatccagaaaaaagacggctatccaacctacaatttt
gctgttgttattgatgatcacgatatgcaaatctcacacgttatccgcggagatgaccat
attgccaatacgccaaagcagttgatggtttacgaggcgcttggctgggaagcacccgtc
tttggtcatatgacccttatcattaattctgagacaggtaaaaagctatcaaagcgtgat
accaataccctgcagtttattgaggattaccgcaaaaaaggctatatgccagaggcagtc
tttaattttattgcccttttaggctggaatcctggcggggaggctgagatcttttctcgt
gagcaattgattgccttatttgatgagattcgtcttagcaagtcgccagcagcctttgat
cagaaaaaaatggactggatgagcaatgagtactttaagcatgctgatcttggcgctgta
tatgcgctttgtaagccatttcttgaagcagcaggccgcttgactgaaaaagcagagaag
ctagttgagctctatcagcctcaattaagctctgctgatgagattgttccattgactgat
ttatttttctcagatttcccagagctgaccgcaaaagaaaaagaagtgatggcagctgag
actgttccaacagttctgaaggccttcaaggaaaagctagaggcgatgtcagatgaggac
tttaagccagaaaacattttcccacaaatcaaggctgtccaaaaagaaaccggcattaag
ggcaagaacctctttatgccaattcgtattgctgtttctggagaaatgcatggcccagag
ctgccaaataccatttacctccttggacgtgaacaatcgattgagcatattgccaatatg
ctttaa

DBGET integrated database retrieval system