KEGG   Streptococcus equi subsp. equi 4047: SEQ_0394Help
Entry
SEQ_0394          CDS       T00877                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:seu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(374041..376440)
Genome map
AA seq 799 aa AA seqDB search
MEHFFTGTVDRIIFDNASNFFKILLLAIEDTDSDFDEADIVITGTMAEIIEGEAYTFWGE
LTQHPRYGQQLRLSRYQKAKPTSAGLVSYFSSEHFKGIGQKTAEKIIALYGNNPIDEILK
NPSRLNEISSLSKANREAFVAKLKANYGTEQVIAALADLGLANRFAFQLFDKYKEEAVHI
VKDNPYQLIEDIQGFGFKLADSLAEQLGIESASPKRFRAALLHCLLEQSIKRGDTYIQAR
ELLALTISLLEDTRPVECDPAIVANQLTQLIDEGKVMTIGTRVFDSSLYYAEDGIQKHLT
RLLQQPLTKEPSQDTIDQEIQAIQEELAITYDKIQKQAISQALTSKVFILTGGPGTGKTT
VIRGILQAYASLYQIDLKQKDIPIILAAPTGRAARRMNELTGLASATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLTAINSNTQLIIVGDSDQLPSVGPGQVLADLL
KVDRIPHITLDKIFRQSEESTIVDLANHIRQGILAPDFCQKKADRSYFEAQAPFIPGMMT
KIVQAALKSGIPAEEIQILAPMYKGLAGINSLNQLMQNLLNPLANQTEFLFNETAFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDEIIMDFDGTEIVYPRNEWLKITLAY
AMSIHKSQGSEFQVVILPVTRQSGRLLQRNLIYTAITRSKSKLIMLGEIAAFEEAIKKEG
DKRHTYLVQRLQVAEADDHTAAASVKESNQSSLSVMPATSPQKEQEQPLYLLTPHNFLAI
DPMIGLTEDDMLTFFKKKS
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaacacttttttacaggcactgttgaccgaattatctttgacaatgcgtcaaatttt
ttcaaaattctattactggctatagaggatactgatagtgattttgatgaagctgacatt
gtcattacaggcactatggctgagatcatagagggcgaagcctataccttttggggtgag
ctgacccagcacccaaggtatggtcagcagctgcgcctgagccgctatcaaaaggctaag
cccacctcagcaggtctcgttagctatttttccagtgagcatttcaagggcattgggcaa
aaaacagctgagaaaatcattgccctttacggtaataatcctattgatgagattttaaaa
aatcccagtcggcttaatgagatctctagcctttctaaggctaatcgtgaagcctttgtg
gcaaagcttaaagccaattatggcactgagcaggtgattgctgccttggctgatctagga
ctggccaatcgctttgcctttcagctatttgacaaatacaaggaagaggctgttcatatc
gtcaaggacaatccttatcaactcattgaggacattcaaggctttggctttaagctggct
gatagcttagctgaacagctaggaattgagagtgcctctcccaagcgctttcgtgcggct
ctgctgcattgcctgttggagcaatccatcaagcgaggcgacacctatatccaggcacgt
gagcttttggcgctgaccattagcctattagaggacacaaggccagtcgaatgcgaccca
gctattgtcgctaatcagctaacccagctcatcgacgagggcaaggttatgactattggc
acgcgtgtttttgacagcagcctttattatgccgaagacggcattcaaaagcatctgaca
cgcttactacagcagcctctgactaaggagcctagtcaagataccattgaccaagaaatc
caagccatacaagaggagcttgctataacctatgacaagatccaaaagcaggccatcagc
caggcactgaccagcaaggttttcattctaacaggaggcccaggcacaggaaagacaacc
gttatcaggggcattttacaggcctatgccagcctgtaccagattgacctgaaacaaaag
gatattcccattatcctagcagctccaactggtcgagccgctcgtcgtatgaacgaatta
accggtctagcaagcgcaactattcaccgccatcttgggttaaacggagacaatgattac
caagcaatggaggattatttagactgtgatttgctgattgttgatgaattttccatggtt
gatacctggctggccaatcagctattaacagccatcaattctaatacccagctgatcatc
gtaggagatagcgaccagctgccttctgtcggtcctggacaggtactagctgacttgcta
aaggttgatcggatccctcacattacccttgacaagatttttcgccaatcagaggagtca
accattgttgatttagccaaccacatacgccaaggcattcttgctcctgatttttgtcag
aaaaaggctgatcgctcctactttgaagcgcaagcgccattcattcccggcatgatgaca
aagatcgtacaggctgccctaaaaagtggcatcccagctgaggaaattcaaatcctagcc
cctatgtacaaaggactagcaggcatcaacagcctcaaccagctcatgcaaaacctcctg
aatcctctagctaatcagacagaatttctctttaacgagacggcctttcgtaagggagac
aaggtacttcaccttgtcaatgacgctcagcttaatgtcttcaatggtgatattggctat
atcacagacctcattccagccaaatataccgaatccaagcaggacgaaatcatcatggac
tttgatggcaccgagatcgtctacccaagaaatgaatggttaaaaatcacccttgcctat
gccatgagcattcacaaatctcaaggcagtgaatttcaggtggtaatcctgcctgtcacc
cgtcagagtggtcgacttctgcaaagaaacctcatctacactgccatcaccagatcaaaa
agcaagctcatcatgctcggagaaatagccgcctttgaagaggcaatcaaaaaagaaggt
gacaagcgacacacctatctcgtacaaaggcttcaagtggctgaagctgatgaccataca
gcagctgcttcagtaaaggaatcaaatcagtctagcctatctgtaatgccagctaccagc
ccacaaaaggaacaagagcagcctctttatctgctcacccctcataatttcctagctata
gaccccatgattggtctaaccgaagatgatatgttaaccttttttaagaaaaaatcataa

DBGET integrated database retrieval system