KEGG   Streptococcus equi subsp. equi 4047: SEQ_0613Help
Entry
SEQ_0613          CDS       T00877                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:seu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:seu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:seu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:seu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:seu00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:seu00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
595082..596053
Genome map
AA seq 323 aa AA seqDB search
MSQKLIGIDLGGTTIKFGILTSEGDVQEKWAIETNVLEDGKHIVPDIVASLKHRLDLYGL
TKDDFIGIGMGSPGAVNRTDHTVTGAFNLNWRGTQEVGSVIERELGIPFAIDNDANVAAL
GERWVGAGDNNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPLKGFACTCG
SQGCLETVASATGVVKVARLLAEAYEGDSSIKAAIDNGEAVSSKDIFVAAEAGDAFANSV
VEKVSYYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFMTFTFPQVRQSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattgatagggattgatttgggcggaaccacgattaaatttggtatttta
acctcagagggtgacgttcaggaaaaatgggcgattgagacaaatgttttagaggacggt
aaacatatcgttccagatattgtcgcctcactcaagcatcgccttgacctttatggactg
actaaggacgattttatcggtattggtatgggctcacctggagctgtcaatcgcacagat
catactgttacaggggcctttaacctcaactggagaggcacccaagaggtgggatctgtt
attgaaagggagctaggaattccctttgctattgataatgacgcaaatgttgcggccctc
ggcgagcgctgggtcggtgcaggtgacaataatcctgatgtggtctttatgaccttagga
acaggtgttggtggtggtatcatcgctgatgggaacttgattcatggtgtggctggagct
ggtggtgagattgggcacatgatagtagagccgcttaagggctttgcttgcacctgtggc
tcacagggctgcctggagacagtggcctctgctacaggtgttgttaaggttgctcgtctt
ttagcagaagcctacgaaggagattcaagcattaaggcagcgattgataatggagaggct
gtctcaagcaaggacatttttgttgcagcggaggctggtgatgcctttgccaactctgtt
gttgaaaaggtcagttattatctaggactggcagcggctaatatctcaaatattttgaac
cctgattcggtcgttattggcggtggtgtatctgctgcgggtgagtttttacgttcacgt
gttgaaaagtactttatgacctttacctttccgcaggttagacagtccactaaaatcaaa
atagcagagcttggtaatgatgctggtattattggtgcagctagccttgcaagacaattt
atcacagaatag

DBGET integrated database retrieval system