KEGG   Streptococcus equi subsp. equi 4047: SEQ_0613Help
Entry
SEQ_0613          CDS       T00877                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00052  Galactose metabolism
seu00500  Starch and sucrose metabolism
seu00520  Amino sugar and nucleotide sugar metabolism
seu00521  Streptomycin biosynthesis
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01200  Carbon metabolism
Module
seu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_0613
   00052 Galactose metabolism
    SEQ_0613
   00500 Starch and sucrose metabolism
    SEQ_0613
   00520 Amino sugar and nucleotide sugar metabolism
    SEQ_0613
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SEQ_0613
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SEQ_0613
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SEQ_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CAW92910
UniProt: C0M686
Position
595082..596053
Genome map
AA seq 323 aa AA seqDB search
MSQKLIGIDLGGTTIKFGILTSEGDVQEKWAIETNVLEDGKHIVPDIVASLKHRLDLYGL
TKDDFIGIGMGSPGAVNRTDHTVTGAFNLNWRGTQEVGSVIERELGIPFAIDNDANVAAL
GERWVGAGDNNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPLKGFACTCG
SQGCLETVASATGVVKVARLLAEAYEGDSSIKAAIDNGEAVSSKDIFVAAEAGDAFANSV
VEKVSYYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFMTFTFPQVRQSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattgatagggattgatttgggcggaaccacgattaaatttggtatttta
acctcagagggtgacgttcaggaaaaatgggcgattgagacaaatgttttagaggacggt
aaacatatcgttccagatattgtcgcctcactcaagcatcgccttgacctttatggactg
actaaggacgattttatcggtattggtatgggctcacctggagctgtcaatcgcacagat
catactgttacaggggcctttaacctcaactggagaggcacccaagaggtgggatctgtt
attgaaagggagctaggaattccctttgctattgataatgacgcaaatgttgcggccctc
ggcgagcgctgggtcggtgcaggtgacaataatcctgatgtggtctttatgaccttagga
acaggtgttggtggtggtatcatcgctgatgggaacttgattcatggtgtggctggagct
ggtggtgagattgggcacatgatagtagagccgcttaagggctttgcttgcacctgtggc
tcacagggctgcctggagacagtggcctctgctacaggtgttgttaaggttgctcgtctt
ttagcagaagcctacgaaggagattcaagcattaaggcagcgattgataatggagaggct
gtctcaagcaaggacatttttgttgcagcggaggctggtgatgcctttgccaactctgtt
gttgaaaaggtcagttattatctaggactggcagcggctaatatctcaaatattttgaac
cctgattcggtcgttattggcggtggtgtatctgctgcgggtgagtttttacgttcacgt
gttgaaaagtactttatgacctttacctttccgcaggttagacagtccactaaaatcaaa
atagcagagcttggtaatgatgctggtattattggtgcagctagccttgcaagacaattt
atcacagaatag

DBGET integrated database retrieval system