KEGG   Streptococcus equi subsp. equi 4047: SEQ_0656Help
Entry
SEQ_0656          CDS       T00877                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SEQ_0656
   01230 Biosynthesis of amino acids
    SEQ_0656
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_0656
  Energy metabolism
   00680 Methane metabolism
    SEQ_0656
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEQ_0656
Enzymes [BR:seu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SEQ_0656
Exosome [BR:seu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SEQ_0656
  Exosomal proteins of melanoma cells
   SEQ_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
637805..638500
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYAHLDHSVIPDAENLKVTLERALPFWEDKIAPALVDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMNVEIPNFPPLVFEFDDKLNLTAEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgtcatggtgagtcagaatggaacaaagcaaaccttttc
actggttgggctgacgttgatttgtccgaaaagggaacacagcaggctattgatgctgga
aaattgatcaaggaagctggtattgcatttgatcttgcctttacatctgtgcttaagcgt
gctatcaagacaactaatcttgcacttgagtattctgatcagctttgggtacctgttgaa
aaatcatggcgcttgaacgagcgtcactatggtggcttgactggtaaaaacaaggcagaa
gcagctgagcaatttggtgatgagcaggttcatatctggcgccgttcatacgatgtgttg
cctcctgatatggctaaagatgatgagcattcagcacatactgatcgtcgttacgctcat
cttgatcattctgttattccagatgcagaaaacctgaaggtaacactagagcgtgccctt
cctttctgggaagataagattgcaccagccttagttgatggtaaaaatgtttttgttgga
gcacatggtaactctattcgtgcccttgtcaaacacatcaagcaattatcagatgacgag
attatgaatgtggaaatcccgaacttcccaccgcttgtgtttgaatttgatgacaagcta
aatcttactgctgagtactacctcggtggtgaataa

DBGET integrated database retrieval system