KEGG   Streptococcus equi subsp. equi 4047: SEQ_0661Help
Entry
SEQ_0661          CDS       T00877                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:seu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SEQ_0661 (recR)
DNA repair and recombination proteins [BR:seu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SEQ_0661 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643150..643746
Genome map
AA seq 198 aa AA seqDB search
MLYPIPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDSSRDKEIILVVEDSKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMAGEATEVIVATNATADGEATAMYISRLLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttaccctataccaatcgcaaaattaattgaaagctattctaaattaccagggatt
ggtgttaaaacagcgacaagattggctttttacaccattggaatgtctgatgaggatgtg
aatgattttgccaaaaatttattagcagctaagcgagaattaacctattgctctatctgt
ggcaatttgacagatgatgatccctgccatatttgcacagatagcagtcgggataaagag
atcattttagttgttgaggattccaaggacgtttctgccatggaaaaaattcaagaatat
catggctattaccatgtgctgcatggcttgatttctcccatgaatggggttggcccagat
gacatcaatctaaagagcctaatcacgcgtttgatggctggagaggcaacagaggtcatt
gttgcaacgaatgccacagcagatggagaggcgactgcgatgtacatctcacgtctccta
aagcctgctggtatcaaggtgacgcgattggctagaggcttggcagtaggatcagacatt
gaatatgctgatgaggtaaccctgctgcgagcgattgaaaatcggacagaattatag

DBGET integrated database retrieval system