KEGG   Streptococcus equi subsp. equi 4047: SEQ_0720Help
Entry
SEQ_0720          CDS       T00877                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SEQ_0720
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SEQ_0720
Enzymes [BR:seu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SEQ_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709447..711237
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKKPYSLDEEAICWVEDTIAAMTLEEKIGQLFVNMGASRSEDYLTQVLEDYHI
AAVRYNKGMASEIWDQNYILQTKSKIPMLIAANTEAGGDGAVNDGTKVGDEIKVAATNDP
KYAYEMGRIAGLEASAVGCNASFAPIVDLTRNWRNPIIANRNWGVNVDQIIELSKEYMKG
IMEYGIMPFAKHFPGDGIDERDHHLSFASNPMTKEEWLSSFGRIYGELAEAGLPGIMAGH
IHLPNVEKAMHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTASMPRR
LLLPTAIEAGCDLFLFFNDPDEDLQWMKEGYEAGILSDERLHDALRRTLGLKAKLGLHRF
EGHREDIMLPKDKAMVLINTPEAQAIADEVADKAITLVKNKQAGIFPVTPERYKRVLIVN
VEGYKGGFGAMIAGQKKRASDIVKELLEARGHEVTVWESTEERIMQLPEEERAAAIANVY
AQKQPISNITEHYDLILNLVDVNSGGTVQRIIWPAAKGTPDQPFYVHEVPTIVVSVQHAF
ALADMPQVGTYINAYDGKDNTMKALVAKLAGESEFTGVSPVDAFCGLIDTQLWHSF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagtagatttaagaaaaaaaccatatagcctagacgaagaagctatttgc
tgggtggaggataccattgcagcaatgaccttggaggagaagataggtcagctatttgtt
aatatgggggctagtcgatcagaggattatttaactcaggtgcttgaggattatcatatt
gcagctgttcgctacaataaaggcatggcttcagaaatttgggatcaaaattatatttta
caaaccaaatccaagattccaatgctcattgctgccaatacagaggctggtggtgatggt
gctgtcaatgatggcactaaggttggtgatgaaatcaaggtagctgcgacaaacgatcct
aaatacgcttatgaaatgggacggattgcaggactggaagcgtcagctgttggctgtaat
gcctcctttgcgccaattgttgatttgacgcgtaattggcgtaatccaatcattgctaat
cgcaactggggggtaaatgttgatcaaatcattgagctttccaaagagtatatgaagggg
attatggaatatggtatcatgccctttgccaagcacttccctggtgatggtattgatgag
cgtgaccatcatttgtcctttgcctcaaacccaatgaccaaggaggagtggctatctagc
tttggacgtatttatggcgagcttgcagaggctggcttacctggtattatggcaggacat
attcacctgccaaatgttgaaaaggccatgcaccctgagcgtgagctagatgatatgctt
ccagcctcacttaataaaaccctcttagatgagctgctgcgtggtgagcttggctataat
ggtgctattgtgactgacgcttcgcatatggttgcgatgacagcctcaatgccacgtcgc
ttattgttaccaacagcgattgaggcaggctgcgatctctttttattctttaatgaccca
gatgaagacctacaatggatgaaagagggctatgaggcaggaattttaagtgacgaacgc
cttcatgacgcccttcgtcgtacgcttggcttgaaagcaaagcttggacttcatcgcttt
gaaggacaccgagaagatattatgctgcctaaggacaaggcgatggtcttgattaacaca
ccagaggctcaagcaattgcagatgaggttgccgacaaggccattacccttgtgaaaaac
aagcaggcagggattttcccggtaactccagagcgctacaagcgtgtgctgattgttaac
gtggagggctataagggtggctttggtgctatgattgcaggacagaagaaacgggcctca
gacattgtcaaggaattgctagaggcgcgtgggcatgaggtaactgtctgggaatcaacc
gaagagcgaatcatgcagctaccagaggaagagcgtgcagcggctattgctaatgtttat
gcacaaaagcagccgatttcaaacattacagagcattatgatttaattcttaatttggtg
gacgtcaattctggaggtacagttcagcgtattatctggccagctgctaagggaacaccg
gatcagccattctacgtccatgaggtcccaacaatcgttgtttcagttcagcatgccttt
gcccttgctgatatgccacaggttggtacttatattaatgcctacgatggcaaggacaac
actatgaaggctttggttgcaaaattagctggtgaatctgaattcactggagtgtctcct
gttgatgccttttgtggcttgattgatacccagctatggcatagcttctga

DBGET integrated database retrieval system