KEGG   Streptococcus equi subsp. equi 4047: SEQ_0720Help
Entry
SEQ_0720          CDS       T00877                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:seu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:seu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709447..711237
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKKPYSLDEEAICWVEDTIAAMTLEEKIGQLFVNMGASRSEDYLTQVLEDYHI
AAVRYNKGMASEIWDQNYILQTKSKIPMLIAANTEAGGDGAVNDGTKVGDEIKVAATNDP
KYAYEMGRIAGLEASAVGCNASFAPIVDLTRNWRNPIIANRNWGVNVDQIIELSKEYMKG
IMEYGIMPFAKHFPGDGIDERDHHLSFASNPMTKEEWLSSFGRIYGELAEAGLPGIMAGH
IHLPNVEKAMHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTASMPRR
LLLPTAIEAGCDLFLFFNDPDEDLQWMKEGYEAGILSDERLHDALRRTLGLKAKLGLHRF
EGHREDIMLPKDKAMVLINTPEAQAIADEVADKAITLVKNKQAGIFPVTPERYKRVLIVN
VEGYKGGFGAMIAGQKKRASDIVKELLEARGHEVTVWESTEERIMQLPEEERAAAIANVY
AQKQPISNITEHYDLILNLVDVNSGGTVQRIIWPAAKGTPDQPFYVHEVPTIVVSVQHAF
ALADMPQVGTYINAYDGKDNTMKALVAKLAGESEFTGVSPVDAFCGLIDTQLWHSF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagtagatttaagaaaaaaaccatatagcctagacgaagaagctatttgc
tgggtggaggataccattgcagcaatgaccttggaggagaagataggtcagctatttgtt
aatatgggggctagtcgatcagaggattatttaactcaggtgcttgaggattatcatatt
gcagctgttcgctacaataaaggcatggcttcagaaatttgggatcaaaattatatttta
caaaccaaatccaagattccaatgctcattgctgccaatacagaggctggtggtgatggt
gctgtcaatgatggcactaaggttggtgatgaaatcaaggtagctgcgacaaacgatcct
aaatacgcttatgaaatgggacggattgcaggactggaagcgtcagctgttggctgtaat
gcctcctttgcgccaattgttgatttgacgcgtaattggcgtaatccaatcattgctaat
cgcaactggggggtaaatgttgatcaaatcattgagctttccaaagagtatatgaagggg
attatggaatatggtatcatgccctttgccaagcacttccctggtgatggtattgatgag
cgtgaccatcatttgtcctttgcctcaaacccaatgaccaaggaggagtggctatctagc
tttggacgtatttatggcgagcttgcagaggctggcttacctggtattatggcaggacat
attcacctgccaaatgttgaaaaggccatgcaccctgagcgtgagctagatgatatgctt
ccagcctcacttaataaaaccctcttagatgagctgctgcgtggtgagcttggctataat
ggtgctattgtgactgacgcttcgcatatggttgcgatgacagcctcaatgccacgtcgc
ttattgttaccaacagcgattgaggcaggctgcgatctctttttattctttaatgaccca
gatgaagacctacaatggatgaaagagggctatgaggcaggaattttaagtgacgaacgc
cttcatgacgcccttcgtcgtacgcttggcttgaaagcaaagcttggacttcatcgcttt
gaaggacaccgagaagatattatgctgcctaaggacaaggcgatggtcttgattaacaca
ccagaggctcaagcaattgcagatgaggttgccgacaaggccattacccttgtgaaaaac
aagcaggcagggattttcccggtaactccagagcgctacaagcgtgtgctgattgttaac
gtggagggctataagggtggctttggtgctatgattgcaggacagaagaaacgggcctca
gacattgtcaaggaattgctagaggcgcgtgggcatgaggtaactgtctgggaatcaacc
gaagagcgaatcatgcagctaccagaggaagagcgtgcagcggctattgctaatgtttat
gcacaaaagcagccgatttcaaacattacagagcattatgatttaattcttaatttggtg
gacgtcaattctggaggtacagttcagcgtattatctggccagctgctaagggaacaccg
gatcagccattctacgtccatgaggtcccaacaatcgttgtttcagttcagcatgccttt
gcccttgctgatatgccacaggttggtacttatattaatgcctacgatggcaaggacaac
actatgaaggctttggttgcaaaattagctggtgaatctgaattcactggagtgtctcct
gttgatgccttttgtggcttgattgatacccagctatggcatagcttctga

DBGET integrated database retrieval system