KEGG   Streptococcus equi subsp. equi 4047: SEQ_0773Help
Entry
SEQ_0773          CDS       T00877                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SEQ_0773
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SEQ_0773
Enzymes [BR:seu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SEQ_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(766115..766618)
Genome map
AA seq 167 aa AA seqDB search
MTSIYDFSVKRQDGTDCSLEQYQGKVLLVVNTATKCGLTPQYQALQELYDTYREQGFEIL
DFPCNQFLHQAPGDATEINAFCSLTYQTTFPRFAKIKVNGKETEPLFTWLKEQKSGPLGK
CIEWNFAKFLIDQKGQVVERYASKTDPKMIEKALQQLLSQEPIDQSD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgactttagcgttaaaagacaagatggcactgattgttcactggag
caataccaaggaaaggtcctattagtggtcaacaccgccactaaatgcggattaactcct
caatatcaagcattacaagagctttatgacacctacagggaacaaggctttgaaatcctt
gatttcccctgcaatcaatttttacatcaggcaccgggtgatgctacagaaatcaatgcc
ttttgcagcttaacttaccagaccaccttcccacgctttgccaaaatcaaggtcaacggc
aaggagacagagccattattcacttggctcaaagaacaaaaaagtggcccactcggcaag
tgcatcgaatggaacttcgcaaaatttttaattgatcaaaaggggcaggttgttgagcgc
tatgcctcaaaaacagaccccaaaatgattgaaaaagccctacagcaattgctttcccaa
gagccaattgaccaatcagactaa

DBGET integrated database retrieval system