KEGG   Streptococcus equi subsp. equi 4047: SEQ_1004Help
Entry
SEQ_1004          CDS       T00877                                 

Definition
ABC transporter ATP-binding protein
Orthology
K01990  
ABC-2 type transport system ATP-binding protein
Organism
seu  Streptococcus equi subsp. equi 4047
Module
ABC-2 type transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(991393..992091)
Genome map
AA seq 232 aa AA seqDB search
MAQLLQLHHVSKSYKKQLAIDDLTITIPSGKIIGLLGPNGSGKTTLIKLINGLLQPDKGD
IVIDGFRPSVETKKIISYLPDTTYLNESMKIKDMLDFFGDFYADFDRDKATSLLKDLDLD
AEERFKNLSKGNKEKAQLILVMSRKAKLYILDEPIGGVDPAARDYILKTIINNYSEQASV
IISTHLISDIEPVLDEAIFLKNGKLCLSGNADDLRVQHQQSIDSLFREIYKV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactattacagctgcaccacgtctcaaaatcttacaaaaaacaattagctatt
gatgatttaaccataacaatcccttctggaaaaattatcggcttactaggaccaaatggt
agcggcaaaactacactaattaagctaatcaacggacttttacagccagacaagggagac
attgttattgacggctttagaccatctgtagaaactaaaaaaatcatttcttacttacca
gatacgacctatcttaatgaaagtatgaaaatcaaggatatgctagacttttttggtgat
ttctatgccgattttgacagagataaagcgaccagtctcctgaaggatttagacttagat
gctgaagagcgctttaaaaacctatcaaagggaaataaggaaaaggcacagcttatcctc
gtgatgagccgcaaagcaaagctctatatccttgatgagcctatcggaggggttgacccg
gcagcaagagattatattcttaaaaccattattaataattactctgagcaagcctctgtt
atcatttctactcacctcatctcagacattgagcctgtacttgatgaagctattttctta
aaaaatggtaagctctgcctttctggaaacgctgatgatttacgagttcagcatcagcaa
tcgattgattcattatttagagagatctacaaggtttag

DBGET integrated database retrieval system