KEGG   Streptococcus equi subsp. equi 4047: SEQ_1011Help
Entry
SEQ_1011          CDS       T00877                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00030  Pentose phosphate pathway
seu00051  Fructose and mannose metabolism
seu00052  Galactose metabolism
seu00680  Methane metabolism
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01200  Carbon metabolism
seu01230  Biosynthesis of amino acids
seu03018  RNA degradation
Module
seu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_1011
   00030 Pentose phosphate pathway
    SEQ_1011
   00051 Fructose and mannose metabolism
    SEQ_1011
   00052 Galactose metabolism
    SEQ_1011
  Energy metabolism
   00680 Methane metabolism
    SEQ_1011
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SEQ_1011
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SEQ_1011
Protein phosphatases and associated proteins [BR:seu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SEQ_1011
Messenger RNA biogenesis [BR:seu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SEQ_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAW93596
UniProt: C0M8V6
Position
999308..1000321
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIHKVVSTIKDDFENRGKNHHIIVLAEGVMSGEAFAQQLKEAGD
ESDLRVTNLGHILRGGSPTARDRVIASWMGAHAVELLKEGKGGLAVGIHNEELVESPILG
SAEDGALFSLTDEGNIVVNNPHKARLDYAALNRSLAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgacgcccctggtatgaatgctgctatt
cgtgcagttgttcgtaaagcaatttcagaaggaatggaagtctatggtattaaccgcggc
tatgctggtatggttgatggtgatatctttccactaggctcaaaagaggttggtgataag
atttctcgcggcgggaccttcctttattcagctcgctacccagagtttgctcagcttgag
gggcaattggctggtattgagcagctaaaaaagcatggcattgaaggggtagttgtcatt
ggtggtgatggttcttaccatggtgcgatgcgcttgactgagcatggcttccctgcagta
ggtatcccagggacgattgataacgatattgctggaacagactatactatcggatttgac
actgcggtcaatactgcggtagaggctattgataagcttcgcgatacctcatcaagtcat
ggacggacctttgttgttgaagtgatgggacgcaatgcaggtgatatcgcactttgggca
ggtattgcaagtggagcagatcaaatcatcgttcctgaagaggaatttgacattcataaa
gtggtctcaacaattaaagacgattttgaaaatagaggaaaaaatcaccatattatcgtt
ttagctgagggtgttatgagtggcgaggcctttgcgcagcagctaaaagaagctggagat
gaaagtgaccttcgtgtgacaaaccttggtcatatccttcgcggtggctctccaactgcg
cgtgatcgtgtgattgcgtcatggatgggagcgcacgctgttgagttgctcaaggaaggc
aaaggtggcttggctgttggtattcataatgaagagcttgttgaaagtccgattcttgga
agtgcagaggacggtgccttgttcagccttactgatgagggtaacattgttgttaataac
ccgcacaaggctcgcttagactatgctgctttgaaccgttcattagcacaatag

DBGET integrated database retrieval system