KEGG   Streptococcus equi subsp. equi 4047: SEQ_1011Help
Entry
SEQ_1011          CDS       T00877                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SEQ_1011
   01230 Biosynthesis of amino acids
    SEQ_1011
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_1011
   00030 Pentose phosphate pathway
    SEQ_1011
   00051 Fructose and mannose metabolism
    SEQ_1011
   00052 Galactose metabolism
    SEQ_1011
  Energy metabolism
   00680 Methane metabolism
    SEQ_1011
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SEQ_1011
Protein phosphatases and associated proteins [BR:seu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SEQ_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999308..1000321
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIHKVVSTIKDDFENRGKNHHIIVLAEGVMSGEAFAQQLKEAGD
ESDLRVTNLGHILRGGSPTARDRVIASWMGAHAVELLKEGKGGLAVGIHNEELVESPILG
SAEDGALFSLTDEGNIVVNNPHKARLDYAALNRSLAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgacgcccctggtatgaatgctgctatt
cgtgcagttgttcgtaaagcaatttcagaaggaatggaagtctatggtattaaccgcggc
tatgctggtatggttgatggtgatatctttccactaggctcaaaagaggttggtgataag
atttctcgcggcgggaccttcctttattcagctcgctacccagagtttgctcagcttgag
gggcaattggctggtattgagcagctaaaaaagcatggcattgaaggggtagttgtcatt
ggtggtgatggttcttaccatggtgcgatgcgcttgactgagcatggcttccctgcagta
ggtatcccagggacgattgataacgatattgctggaacagactatactatcggatttgac
actgcggtcaatactgcggtagaggctattgataagcttcgcgatacctcatcaagtcat
ggacggacctttgttgttgaagtgatgggacgcaatgcaggtgatatcgcactttgggca
ggtattgcaagtggagcagatcaaatcatcgttcctgaagaggaatttgacattcataaa
gtggtctcaacaattaaagacgattttgaaaatagaggaaaaaatcaccatattatcgtt
ttagctgagggtgttatgagtggcgaggcctttgcgcagcagctaaaagaagctggagat
gaaagtgaccttcgtgtgacaaaccttggtcatatccttcgcggtggctctccaactgcg
cgtgatcgtgtgattgcgtcatggatgggagcgcacgctgttgagttgctcaaggaaggc
aaaggtggcttggctgttggtattcataatgaagagcttgttgaaagtccgattcttgga
agtgcagaggacggtgccttgttcagccttactgatgagggtaacattgttgttaataac
ccgcacaaggctcgcttagactatgctgctttgaaccgttcattagcacaatag

DBGET integrated database retrieval system