KEGG   Streptococcus equi subsp. equi 4047: SEQ_1124Help
Entry
SEQ_1124          CDS       T00877                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00790  Folate biosynthesis
seu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SEQ_1124
Enzymes [BR:seu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SEQ_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Ribosomal_L22 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CAW93792
UniProt: C0MA59
Position
1114532..1115155
Genome map
AA seq 207 aa AA seqDB search
MLSHINSSNKINQLKRGKPLPINQKKAEAAIYQLLEAIGEDPNREGLRDTPKRVAKMYLE
MLSGLEQDAKDEFTAVFTEHHDDLVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTG
LSKLARAVEVTSKRPQLQERLTAQIANALVDALQPKGVFVMVEAEHMCMTMRGVKKPGSK
TITTTARGIYKDSRDDRREVMQLIMEG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctttctcacatcaactcatcaaacaagattaatcaactaaaaaggggaaaaccattg
ccaatcaatcaaaaaaaagcagaagccgctatctatcaattattagaagctatcggtgag
gatccaaaccgagaagggctacgagataccccaaagcgtgttgccaagatgtatctagaa
atgctctcagggctggaacaggacgctaaggatgaatttacagctgtttttacagagcat
cacgacgatttggtgattgttaaggatattagcttttattccatgtgtgagcaccatctg
gtgccattttatggtaaggcgcatattgcttatttgcctagtgatgggcgtgtgacaggc
ttgagtaagctggcaagggcagttgaggtgacgagcaaaagacctcagctgcaggagcgt
ttgacagctcagattgctaatgctcttgttgatgccttgcagcccaaaggggtttttgtt
atggtagaagcagagcatatgtgcatgaccatgcgaggtgtcaaaaagccaggcagtaag
accattacgacaactgctagagggatttacaaggatagtagagacgacaggcgtgaggtt
atgcaattaatcatggagggctag

DBGET integrated database retrieval system