KEGG   Streptococcus equi subsp. equi 4047: SEQ_1125Help
Entry
SEQ_1125          CDS       T00877                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SEQ_1125
Enzymes [BR:seu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SEQ_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115163..1115963
Genome map
AA seq 266 aa AA seqDB search
MTIGHYSAAGEAAIMGILNVTPDSFSDGGSYTSVNQALAQAEKMLSEGATVIDIGGESTR
PGCQFVPAEEEIARVVPIIKAIKKRYDVLISIDTYKTETARAALEAGADMLNDVWAGLYD
GQMLSLAAEYDVPIILMHNQTKEAYADVTKEVCSFLQARAAAALKAGVKKEHIWLDPGFG
FAKNVEQNIALLKGLNEVCQLGYPVLFGISRKRVVDALLGGGTKAKDRDGATAALSAYAI
NKGCQMVRVHNVGANRDIVSVLSQLR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactattggacattattcagccgctggtgaggcagctattatggggattttaaatgtg
actccggattcgttttcagatggtggctcctatactagtgttaatcaggccttggcacag
gccgaaaaaatgctgtcagaaggagcgactgtcattgatattggaggcgagtcaacacga
ccgggctgccaatttgtgccggcagaagaagagattgcacgcgttgttccaatcataaag
gccattaaaaaacggtatgatgtccttattagcattgatacctacaagacagaaactgct
agagcggcccttgaagcaggagcagatatgctcaatgatgtctgggcaggactatatgac
ggtcaaatgctaagtctagccgccgaatacgacgttcccattatattaatgcataatcaa
accaaagaggcttatgctgatgttacaaaagaggtttgcagctttttacaggctagagca
gctgcagccctcaaagcaggtgtcaaaaaagaacatatctggcttgatccaggatttggc
tttgctaaaaatgttgagcaaaatatagccttattaaaagggctaaatgaggtttgccag
ttgggctatcctgttctttttgggatttccagaaagcgtgttgtagacgccctacttggt
ggcggcactaaagccaaggatcgtgacggggctactgccgccctatcagcctacgctatt
aataaggggtgtcaaatggtgcgcgtgcataatgtcggtgctaacagggatattgtctct
gtattgagtcaattaaggtga

DBGET integrated database retrieval system