KEGG   Streptococcus equi subsp. equi 4047: SEQ_1127Help
Entry
SEQ_1127          CDS       T00877                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SEQ_1127
Enzymes [BR:seu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SEQ_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1116326..1116832
Genome map
AA seq 168 aa AA seqDB search
MTLVYLGLGTNMGDRAGYLQAAVNALSKLPETELLRQSSIYQTAAWGKTDQNAFLNMACQ
LDTRLTSEALLAATQAIEQALGRVRHEKWGPRTIDIDLLLFGDEPYQSETLVIPHPYMTQ
RAFVLIPLLEIAPDVTLPGSQKSLRSYLDALEQSDVALWSHEYSNKFS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtttatttaggcttgggaactaatatgggagatagggcaggctacctacag
gcagcagttaatgccctatctaagctgccagagactgagttactgagacaatcctctatc
tatcaaacagcagcctggggaaaaacagatcaaaatgcctttttgaatatggcttgccag
ctagatactaggctgacatcagaagctcttttggcagctacgcaggctatcgagcaggct
ctgggacgagttcgtcatgaaaaatggggcccaaggacaattgatattgacctcttgctg
tttggtgatgagccgtatcaatcagagaccttggttattcctcacccttacatgacacaa
agagcctttgttttgattcctttattagagattgcacccgatgtgaccttacctggtagc
cagaaaagcctgaggtcttaccttgatgctttagagcaatcagatgtagccttgtggtca
catgagtattcaaataagttttcttaa

DBGET integrated database retrieval system