KEGG   Streptococcus equi subsp. equi 4047: SEQ_1400Help
Entry
SEQ_1400          CDS       T00877                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SEQ_1400
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SEQ_1400
Enzymes [BR:seu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SEQ_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1396294..1397637
Genome map
AA seq 447 aa AA seqDB search
MKLKTLLAIAAGRTAQLILNKIGRGSTYPGRLALMWDKDILDTLAKDYEIVVVTGTNGKT
LTTALTVGILKEAFGEVLTNPSGANMMTGITSAFLSAKRKKTGKPIAVLEIDEASLARVT
TYIKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGASQAPKATILANGDSPIFASKDLVNP
VKYYGFDTPKHEPRLAHYNTEGILCPKCEQILRYRLNTYANLGDYTCLNCDFQRPKLDYK
LTQLTSITHHSSAFVIDDQTYRINVGGLYNIYNALAAVAVAEFFGISADQIKAGFNKSKA
VFGRQETFSINGKACTLVLIKNPVGASQALEMLRLADYPFSLSVLLNADYADGIDTSWIW
DADFELINQMDITEINAGGVRHSEIARRLRVTGFDEAKITSFDKLEGIMQAIENQEAEHA
YILATYTAMLAFRELLASRHIVEKEMI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaagacactactcgctatagcagccggaaggactgcgcagctcattttaaat
aaaatcggaagaggctcaacctaccccggacgattggccttgatgtgggataaggatatt
ttagacacacttgccaaggactatgagattgttgttgtgacagggacaaatgggaaaacc
ttaaccacagctctaactgttggtatcctaaaagaagcctttggtgaggttttgactaat
ccaagtggcgccaacatgatgacagggattacctctgcctttttatctgctaaaagaaaa
aaaacaggcaagcctattgccgtcttagagattgatgaggcaagccttgcaagggtaaca
acatacattaagccaagtctttttgtttacactaatatctttcgagaccagatggatcgc
tacggtgagatttacaccacctatcagatgattgttgatggtgctagtcaagcgccgaag
gcaaccattctagctaacggtgatagccctatctttgcctcaaaggacctggttaatcct
gttaaatattatggctttgacacacctaagcatgagccacgcctagctcactacaacact
gaaggcattttgtgcccaaaatgtgaacagattctccgttatcgtctcaacacctatgct
aatctaggagactatacctgcttaaattgtgatttccaaaggcctaagttggattacaag
ctaacgcaattaaccagcattacccatcatagctcagcctttgtgattgacgatcagact
tatcgcataaatgttggaggactctataacatctataatgccctcgcagctgttgctgtt
gctgagttttttggcatttctgctgatcagattaaggctggcttcaataaaagcaaggct
gtttttggtcgtcaggaaaccttctccatcaacggtaaagcctgtacgctggttctcatt
aaaaaccctgtgggtgctagtcaggcactagaaatgctgcgcctagccgattatcccttt
agcctatctgtgcttttaaatgctgattatgctgacggtattgacacaagctggatttgg
gatgctgattttgaattgattaatcaaatggacattactgagatcaacgccggtggggtt
cggcattctgaaattgcaagacgcttacgagtgacaggctttgatgaggctaaaatcaca
tcattcgataagcttgaaggtatcatgcaagccattgaaaaccaagaggctgagcatgcc
tatatcctagcgacctatactgctatgctagcatttcgtgagctgcttgccagccgccac
attgtcgaaaaggagatgatctaa

DBGET integrated database retrieval system