KEGG   Streptococcus equi subsp. equi 4047: SEQ_1404Help
Entry
SEQ_1404          CDS       T00877                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00020  Citrate cycle (TCA cycle)
seu00620  Pyruvate metabolism
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01200  Carbon metabolism
Module
seu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_1404
   00020 Citrate cycle (TCA cycle)
    SEQ_1404
   00620 Pyruvate metabolism
    SEQ_1404
Enzymes [BR:seu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SEQ_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAW94255
UniProt: C0M9S3
Position
complement(1402258..1403667)
Genome map
AA seq 469 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVSEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAAGESVDNSTASSEKTTEIPVPTSAEANTTTVPKEAASTAPQV
ASVANAPAFGEKVRATPAARKAASEMGIELNQVPGTGPKGRIHKEDVEGFKGAQPKATPL
ARKIAADKGVDLAAVVGTGIGGKITKEDILAVLGAAAPAVEKASIAEEKPAKELPEGVEI
KKMSAMRKAISKGMTHSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GLAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLVVPVVHGADKMSLSE
FVLASKDVIKKAQGGKLKATEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGIGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgccaaagctcggtgttgacatgcaagaaggcgagatcatc
gagtggaaaaagcaggagggtgacactgttagcgagggtgacattcttcttgaaatcatg
tcagacaagacaaatatggagcttgaagcagaggattcaggtgtgcttctaaaaatcact
cgccaggcaggtgaaacagtccctgtcactgaggttatcggctatattggtgctgcaggt
gaatctgttgataatagtactgcttcaagtgagaaaacaactgaaattccagtaccaaca
tcagcagaagctaatacaacaactgtaccgaaagaagcagcctcaacagcgcctcaggta
gcatcagttgccaatgctccagccttcggagaaaaggtacgcgcaacgccagcagctcgt
aaagcagcttcagaaatgggaattgagcttaaccaagtgccaggaacaggaccaaagggc
cgtatccacaaagaagacgttgaaggcttcaaaggagctcagcctaaggcaacgccactt
gctcgtaagatagctgccgacaagggagttgaccttgcagcggtggtcggaacaggtatt
ggtggcaagattaccaaggaggacattttggctgtgcttggcgcagcagcacctgctgtg
gaaaaagcatctattgctgaagaaaagcctgctaaggagcttccagagggtgttgaaatt
aagaagatgtctgctatgcgtaaggctatttcaaagggtatgacacattcctaccttaca
gcaccaacctttacgcttaattatgacattgacatgaccgaaatgattgccttgcgcaag
aagctgattgacccaatcatggctaaaacagggctaaaggttagctttactgacttgatt
ggtttagccgttgttaagaccttgatgaagccagagcacgaatacatgaatgcgtcattg
attaatgatgctaatgatattgagcttcatcgctttgtcaaccttggtattgctgtagga
cttgatgatgggctagttgtgccagttgttcatggtgcagataagatgagtctctcagag
tttgtccttgcttctaaggacgttatcaaaaaggctcaaggaggcaagctaaaggctacc
gaaatgtcaggctcaaccttctccatcacaaatctgggtatgtttggcaccaaaaccttc
aatccaattatcaatcagcctaattcagctattctaggtattggggcaaccattccaacc
ccaacagtggtcgatggtgagattgttgcacgtccaatcatggcaatgtgtctgacaatt
gaccaccgtctggtggacggcatgaatggtgctaaattcatggttgatctcaaaaaattg
atggaaaatccatttgaactgctaatctga

DBGET integrated database retrieval system