KEGG   Streptococcus equi subsp. equi 4047: SEQ_1418Help
Entry
SEQ_1418          CDS       T00877                                 

Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SEQ_1418
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SEQ_1418
Enzymes [BR:seu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SEQ_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1420533..1421132)
Genome map
AA seq 199 aa AA seqDB search
MMTEQFFDKALACREIEAIPGLLEFDIPVRGDNRGWFKENFQKEKMIPLGFPEQFFAAGK
LQNNISFSRKHVLRGLHAEPWDKYISVADEGKVLGAWVDLREGDSFGHTYQTVIDASKGI
FVPRGVANGFQVLTDKVAYTYLVNDYWALELKQKYAFVNYADPSLGIAWESLEQAEVSEA
DKSHPFLEAVKPLRQEDLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacagaacaattttttgataaagccttagcctgtcgggaaattgaagccattcct
ggacttttggagtttgatatccctgttcgaggggacaatcgtggctggtttaaggaaaat
tttcaaaaggaaaaaatgattcctctaggctttcctgagcagttttttgccgcaggtaag
ctgcaaaacaatatttcattttcgcgcaagcatgtgcttcgaggcctgcatgcagagcct
tgggacaagtacatctctgttgctgatgagggtaaggttcttggagcttgggttgatctt
cgtgagggtgatagctttgggcatacctatcaaacagtcattgacgcttcaaaggggatt
tttgtccctcgaggtgttgctaatggctttcaagtactgactgataaggtggcttatacc
tatctggtcaatgattattgggcgcttgagctcaagcaaaaatatgcctttgttaattat
gctgacccaagccttgggattgcgtgggaaagtcttgaacaagcagaggtttcagaagca
gataaaagccatcccttcctagaggccgttaagcctttgagacaagaagatttatcataa

DBGET integrated database retrieval system