KEGG   Streptococcus equi subsp. equi 4047: SEQ_1463Help
Entry
SEQ_1463          CDS       T00877                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:seu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1471546..1472946)
Genome map
AA seq 466 aa AA seqDB search
MKQSKRRYQFPEGFLWGSSTSGPQSEGTVSGDGKGPSNWDYWFSLEPDKFHHQIGPEVTS
TFYTNYKSDIALLKETGHTAFRTSIQWSRLIPEGVGQVNPKAVAFYREVFQEIMAQDIKL
IVNLYHFDLPYALQGKRGWEAKETVWAYETYAKTCFELFGDLVDTWITFNEPIVPVECGY
LGHYHYPCKVDAKAAVQVAYHTQLASSLAIKACHELYPKHRISIVLNVTPAYPRSDQPED
VKAARIAELFQTKSFLDPSVLGVYPEELVVLLEAADLLPQYSADELAIIKNNPVDFLGVN
YYQPLRVQAPSKTRQDGEPITLASYFEPYDMPGKKVNPHRGWEIYEQGLYDIALNLKEHY
GNIDWLVTENGMGVEGEEAFLVDGQIQDDYRIAFIEDHLIQLHRALEEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLETQKRTLKKSGHWFKTLSQTNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatcaaaacgccgttaccaatttccagaaggttttttgtggggaagctcaaca
tctggccctcaaagtgaggggactgtttctggagatgggaagggacctagcaattgggac
tactggtttagtctggagccagataagtttcatcatcagattggtccagaggtaacctca
accttttacaccaactacaaaagcgatattgctcttttaaaagagaccggtcacacagct
tttcggacctctattcaatggtctcgactgattccagaaggggttggtcaggttaatcca
aaagctgtagccttttaccgagaggtatttcaggaaatcatggctcaggacattaagctg
attgttaacctctatcattttgatctgccttatgccttgcaaggaaagagaggctgggag
gctaaggagacggtctgggcttatgagacctatgctaagacctgttttgagctttttggt
gatttggtggatacatggattacctttaacgaacctattgttccagtcgaatgcggttat
ttggggcattaccactatccttgcaaggtagatgccaaggcagctgttcaagtggcttac
catacccagttggctagctcacttgctatcaaggcctgccacgagttgtatcctaagcat
aggattagtattgtgcttaatgtgactcctgcctatcctagaagtgatcagccagaagat
gtcaaggcagcgagaatcgcagagcttttccagactaaatccttcctagatccgtctgtc
ttaggagtgtacccagaagagttagtagttcttttagaggcagctgatttattgccccag
tatagtgctgatgaattggctattatcaaaaacaatcctgttgatttcttgggagttaat
tactatcaacctttgcgtgtgcaagcgcctagcaaaacaagacaagatggtgaaccaatc
acgctagcctcttattttgaaccttatgatatgccaggcaaaaaggttaaccctcatcgc
ggttgggaaatctatgagcagggcctttacgacattgctcttaatttaaaagagcattat
ggcaatattgactggttagtaactgaaaatggtatgggagtagaaggtgaagaagccttt
ttagttgatggtcagatccaagacgattaccggattgcctttatcgaagaccatttgatt
caattgcacagggctttagaagaaggcgcgaactgtaaaggctacctcctgtggaccttt
attgattgctggtcttggttaaatgcctataaaaatcgttatggcttggtagccttggat
ttagagactcaaaaacgaacccttaaaaaatctggccactggtttaagaccctgagtcag
acaaatggttttgataaatag

DBGET integrated database retrieval system