KEGG   Streptococcus equi subsp. equi 4047: SEQ_1503Help
Entry
SEQ_1503          CDS       T00877                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SEQ_1503 (tpiA)
   01230 Biosynthesis of amino acids
    SEQ_1503 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_1503 (tpiA)
   00051 Fructose and mannose metabolism
    SEQ_1503 (tpiA)
   00562 Inositol phosphate metabolism
    SEQ_1503 (tpiA)
Enzymes [BR:seu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SEQ_1503 (tpiA)
Exosome [BR:seu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SEQ_1503 (tpiA)
  Exosomal proteins of bladder cancer cells
   SEQ_1503 (tpiA)
  Exosomal proteins of melanoma cells
   SEQ_1503 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1509881..1510639)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVKAVVSKLPSNDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENSGAYTGETSPKVLADMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVAFVGAQVSAALEGLSAEQVASLVLAYEPIWAIGTGKSAT
QEDAQSMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENIKEYMACPDVDGALVGGASLE
ADSFLALLDFVN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgccggtaactggaaaatgaacaaaaatcctcaagaggca
aaagcctttgttaaggcagtagtaagcaaattaccttcaaacgatcttgttgacgttgca
gtagcagcaccagctgttgacttggtcactacaattgaggctgctaaggactctgtcctt
aaggttgctgcgcaaaactgttattttgaaaattcaggcgcttatacaggcgaaacctct
cctaaggttcttgctgacatgggagctgattatgtggtgattggtcactctgagcgtcgt
gattacttccacgaaacagacgaagatattaataaaaaagcaaaagccatctttgctaat
ggcttaacaccaattatctgctgcggtgagtctcttgagacctatgaggctggcaaggca
gtagcctttgttggtgcacaggtgtctgcggctctagaggggctatctgctgagcaggtt
gcttcattggtattggcatatgagccaatctgggctatcggtactggtaaatctgccact
caagaagatgctcaaagcatgtgtaaggctgttcgcgatgtggttgctgctgactttggt
caagaggtggcagacaaggttcgtgtacagtatggtggttctgtgaagcctgaaaacatt
aaggagtacatggcttgtccggatgttgacggagctcttgtcggtggtgcatcactagaa
gcagatagcttccttgccttgcttgattttgtcaactaa

DBGET integrated database retrieval system