KEGG   Streptococcus equi subsp. equi 4047: SEQ_1503Help
Entry
SEQ_1503          CDS       T00877                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00051  Fructose and mannose metabolism
seu00562  Inositol phosphate metabolism
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01200  Carbon metabolism
seu01230  Biosynthesis of amino acids
Module
seu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_1503
   00051 Fructose and mannose metabolism
    SEQ_1503
   00562 Inositol phosphate metabolism
    SEQ_1503
Enzymes [BR:seu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SEQ_1503
Exosome [BR:seu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SEQ_1503
  Exosomal proteins of bladder cancer cells
   SEQ_1503
  Exosomal proteins of melanoma cells
   SEQ_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAW94426
UniProt: C0M6S6
Position
complement(1509881..1510639)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVKAVVSKLPSNDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENSGAYTGETSPKVLADMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVAFVGAQVSAALEGLSAEQVASLVLAYEPIWAIGTGKSAT
QEDAQSMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENIKEYMACPDVDGALVGGASLE
ADSFLALLDFVN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgccggtaactggaaaatgaacaaaaatcctcaagaggca
aaagcctttgttaaggcagtagtaagcaaattaccttcaaacgatcttgttgacgttgca
gtagcagcaccagctgttgacttggtcactacaattgaggctgctaaggactctgtcctt
aaggttgctgcgcaaaactgttattttgaaaattcaggcgcttatacaggcgaaacctct
cctaaggttcttgctgacatgggagctgattatgtggtgattggtcactctgagcgtcgt
gattacttccacgaaacagacgaagatattaataaaaaagcaaaagccatctttgctaat
ggcttaacaccaattatctgctgcggtgagtctcttgagacctatgaggctggcaaggca
gtagcctttgttggtgcacaggtgtctgcggctctagaggggctatctgctgagcaggtt
gcttcattggtattggcatatgagccaatctgggctatcggtactggtaaatctgccact
caagaagatgctcaaagcatgtgtaaggctgttcgcgatgtggttgctgctgactttggt
caagaggtggcagacaaggttcgtgtacagtatggtggttctgtgaagcctgaaaacatt
aaggagtacatggcttgtccggatgttgacggagctcttgtcggtggtgcatcactagaa
gcagatagcttccttgccttgcttgattttgtcaactaa

DBGET integrated database retrieval system