KEGG   Streptococcus equi subsp. equi 4047: SEQ_1610Help
Entry
SEQ_1610          CDS       T00877                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:seu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1615880..1616773)
Genome map
AA seq 297 aa AA seqDB search
MLKLAGSAGFGYVVSLLARLVSLIMPELPEVETVRRGLERLVVGKQIAAVTVRVPKMVKT
DLEHFVMTIPGQQVQGVDRRGKYLLFDFGQLVMISHLRMEGKYLLFPDTVPEHKHFHVFL
TMTDGSTLVYQDVRKFGTFDLLPKAELAAFFQKRQLGPEPTKQTFQLKTFEAALLASKKT
IKPHLLDQTLVAGLGNIYVDEVLWAARVHPERRSASLKKAEIKRIHDETIRILQLGIEKG
GSTVRTYQNTLGMNGSMQHYLMVYGQTGKPCQRCGTSIVKLKVGGRGTHVCPRCQKQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaactggctggttctgctggttttggttatgtggtttctttgttagcgcgtttg
gtatctttaattatgcctgaactccctgaggttgagacagtgcgacgcgggcttgagcgc
ttagtcgttggcaagcagattgcagcagtgacagttagggtgcccaagatggtcaaaaca
gaccttgagcattttgtgatgacgatccctgggcagcaggtgcaaggggtagatcgtcgc
gggaagtacctgctctttgactttggccagctggttatgatctcgcatttgcgtatggag
gggaaatacctcttgtttcctgatacggtacctgagcataagcattttcatgtctttttg
acaatgactgatggctccacgctggtttaccaagatgtgagaaagtttggaacctttgat
ttgctaccaaaggctgagctggctgcttttttccagaagcgtcagcttggtcctgagccg
acgaagcagacctttcaattgaagacctttgaggctgctctgctagcctctaaaaagacc
attaagcctcatcttttggatcagactttagtggctggtcttggaaatatctatgtggac
gaggtgctatgggcagctagagtacaccctgagcgtcgatctgctagcctgaaaaaggca
gaaatcaaacggattcatgatgaaacgattcgtattttacaattaggtattgaaaagggt
ggctcgacggttagaacctatcagaataccttaggaatgaatggtagtatgcagcattat
ttgatggtctatggccaaacaggcaagccctgtcagcgctgcgggacctccattgtaaag
ctcaaggttggaggaagagggacacatgtctgtcctaggtgtcagaagcaatga

DBGET integrated database retrieval system